KEGG   Homo sapiens (human): 64750Help
Entry
64750             CDS       T01001                                 

Gene name
SMURF2
Definition
(RefSeq) SMAD specific E3 ubiquitin protein ligase 2
  KO
K04678  E3 ubiquitin ligase SMURF1/2 [EC:2.3.2.26]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04120  Ubiquitin mediated proteolysis
hsa04144  Endocytosis
hsa04340  Hedgehog signaling pathway
hsa04350  TGF-beta signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    64750 (SMURF2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    64750 (SMURF2)
   04350 TGF-beta signaling pathway
    64750 (SMURF2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    64750 (SMURF2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    64750 (SMURF2)
   04121 Ubiquitin system [BR:hsa04121]
    64750 (SMURF2)
   03029 Mitochondrial biogenesis [BR:hsa03029]
    64750 (SMURF2)
Enzymes [BR:hsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.26  HECT-type E3 ubiquitin transferase
     64750 (SMURF2)
Membrane trafficking [BR:hsa04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Ubiquitin E3 ligases
    64750 (SMURF2)
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    64750 (SMURF2)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  HECT type E3
   64750 (SMURF2)
Mitochondrial biogenesis [BR:hsa03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Parkin-independent mechanism factors
    64750 (SMURF2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HECT WW C2
Motif
Other DBs
NCBI-GeneID: 64750
NCBI-ProteinID: NP_073576
OMIM: 605532
HGNC: 16809
Ensembl: ENSG00000108854
Vega: OTTHUMG00000179189
Pharos: Q9HAU4(Tbio)
UniProt: Q9HAU4 Q96DE7
Structure
PDB: 

Position
17q23.3-q24.1
AA seq 748 aa AA seqDB search
MSNPGGRRNGPVKLRLTVLCAKNLVKKDFFRLPDPFAKVVVDGSGQCHSTDTVKNTLDPK
WNQHYDLYIGKSDSVTISVWNHKKIHKKQGAGFLGCVRLLSNAINRLKDTGYQRLDLCKL
GPNDNDTVRGQIVVSLQSRDRIGTGGQVVDCSRLFDNDLPDGWEERRTASGRIQYLNHIT
RTTQWERPTRPASEYSSPGRPLSCFVDENTPISGTNGATCGQSSDPRLAERRVRSQRHRN
YMSRTHLHTPPDLPEGYEQRTTQQGQVYFLHTQTGVSTWHDPRVPRDLSNINCEELGPLP
PGWEIRNTATGRVYFVDHNNRTTQFTDPRLSANLHLVLNRQNQLKDQQQQQVVSLCPDDT
ECLTVPRYKRDLVQKLKILRQELSQQQPQAGHCRIEVSREEIFEESYRQVMKMRPKDLWK
RLMIKFRGEEGLDYGGVAREWLYLLSHEMLNPYYGLFQYSRDDIYTLQINPDSAVNPEHL
SYFHFVGRIMGMAVFHGHYIDGGFTLPFYKQLLGKSITLDDMELVDPDLHNSLVWILEND
ITGVLDHTFCVEHNAYGEIIQHELKPNGKSIPVNEENKKEYVRLYVNWRFLRGIEAQFLA
LQKGFNEVIPQHLLKTFDEKELELIICGLGKIDVNDWKVNTRLKHCTPDSNIVKWFWKAV
EFFDEERRARLLQFVTGSSRVPLQGFKALQGAAGPRLFTIHQIDACTNNLPKAHTCFNRI
DIPPYESYEKLYEKLLTAIEETCGFAVE
NT seq 2247 nt NT seq  +upstreamnt  +downstreamnt
atgtctaaccccggaggccggaggaacgggcccgtcaagctgcgcctgacagtactctgt
gcaaaaaacctggtgaaaaaggattttttccgacttcctgatccatttgctaaggtggtg
gttgatggatctgggcaatgccattctacagatactgtgaagaatacgcttgatccaaag
tggaatcagcattatgacctgtatattggaaagtctgattcagttacgatcagtgtatgg
aatcacaagaagatccataagaaacaaggtgctggatttctcggttgtgttcgtcttctt
tccaatgccatcaaccgcctcaaagacactggttatcagaggttggatttatgcaaactc
gggccaaatgacaatgatacagttagaggacagatagtagtaagtcttcagtccagagac
cgaataggcacaggaggacaagttgtggactgcagtcgtttatttgataacgatttacca
gacggctgggaagaaaggagaaccgcctctggaagaatccagtatctaaaccatataaca
agaactacgcaatgggagcgcccaacacgaccggcatccgaatattctagccctggcaga
cctcttagctgctttgttgatgagaacactccaattagtggaacaaatggtgcaacatgt
ggacagtcttcagatcccaggctggcagagaggagagtcaggtcacaacgacatagaaat
tacatgagcagaacacatttacatactcctccagacctaccagaaggctatgaacagagg
acaacgcaacaaggccaggtgtatttcttacatacacagactggtgtgagcacatggcat
gatccaagagtgcccagggatcttagcaacatcaattgtgaagagcttggtccattgcct
cctggatgggagatccgtaatacggcaacaggcagagtttatttcgttgaccataacaac
agaacaacacaatttacagatcctcggctgtctgctaacttgcatttagttttaaatcgg
cagaaccaattgaaagaccaacagcaacagcaagtggtatcgttatgtcctgatgacaca
gaatgcctgacagtcccaaggtacaagcgagacctggttcagaaactaaaaattttgcgg
caagaactttcccaacaacagcctcaggcaggtcattgccgcattgaggtttccagggaa
gagatttttgaggaatcatatcgacaggtcatgaaaatgagaccaaaagatctctggaag
cgattaatgataaaatttcgtggagaagaaggccttgactatggaggcgttgccagggaa
tggttgtatctcttgtcacatgaaatgttgaatccatactatggcctcttccagtattca
agagatgatatttatacattgcagatcaatcctgattctgcagttaatccggaacattta
tcctatttccactttgttggacgaataatgggaatggctgtgtttcatggacattatatt
gatggtggtttcacattgcctttttataagcaattgcttgggaagtcaattaccttggat
gacatggagttagtagatccggatcttcacaacagtttagtgtggatacttgagaatgat
attacaggtgttttggaccataccttctgtgttgaacataatgcatatggtgaaattatt
cagcatgaacttaaaccaaatggcaaaagtatccctgttaatgaagaaaataaaaaagaa
tatgtcaggctctatgtgaactggagatttttacgaggcattgaggctcaattcttggct
ctgcagaaaggatttaatgaagtaattccacaacatctgctgaagacatttgatgagaag
gagttagagctcattatttgtggacttggaaagatagatgttaatgactggaaggtaaac
acccggttaaaacactgtacaccagacagcaacattgtcaaatggttctggaaagctgtg
gagttttttgatgaagagcgacgagcaagattgcttcagtttgtgacaggatcctctcga
gtgcctctgcagggcttcaaagcattgcaaggtgctgcaggcccgagactctttaccata
caccagattgatgcctgcactaacaacctgccgaaagcccacacttgcttcaatcgaata
gacattccaccctatgaaagctatgaaaagctatatgaaaagctgctaacagccattgaa
gaaacatgtggatttgctgtggaatga

DBGET integrated database retrieval system