KEGG   Homo sapiens (human): 64754Help
Entry
64754             CDS       T01001                                 

Gene name
SMYD3, KMT3E, ZMYND1, ZNFN3A1, bA74P14.1
Definition
(RefSeq) SET and MYND domain containing 3
  KO
K11426  SET and MYND domain-containing protein
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    64754 (SMYD3)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     64754 (SMYD3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SET zf-MYND
Motif
Other DBs
NCBI-GeneID: 64754
NCBI-ProteinID: NP_001161212
OMIM: 608783
HGNC: 15513
Ensembl: ENSG00000185420
Vega: OTTHUMG00000040508
Pharos: Q9H7B4(Tbio)
UniProt: Q9H7B4
Structure
PDB: 

Position
1q44
AA seq 428 aa AA seqDB search
MEPLKVEKFATAKRGNGLRAVTPLRPGELLFRSDPLAYTVCKGSRGVVCDRCLLGKEKLM
RCSQCRVAKYCSAKCQKKAWPDHKRECKCLKSCKPRYPPDSVRLLGRVVFKLMDGAPSES
EKLYSFYDLESNINKLTEDKKEGLRQLVMTFQHFMREEIQDASQLPPAFDLFEAFAKVIC
NSFTICNAEMQEVGVGLYPSISLLNHSCDPNCSIVFNGPHLLLRAVRDIEVGEELTICYL
DMLMTSEERRKQLRDQYCFECDCFRCQTQDKDADMLTGDEQVWKEVQESLKKIEELKAHW
KWEQVLAMCQAIISSNSERLPDINIYQLKVLDCAMDACINLGLLEEALFYGTRTMEPYRI
FFPGSHPVRGVQVMKVGKLQLHQGMFPQAMKNLRLAFDIMRVTHGREHSLIEDLILLLEE
CDANIRAS
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atggagccgctgaaggtggaaaagttcgcaaccgccaagaggggaaacgggctgcgcgcc
gtgaccccgctgcgccccggagagctactcttccgctcggatcccttggcgtacacggtg
tgcaaggggagtcgtggcgtcgtctgcgaccgctgccttctcgggaaggaaaagctgatg
cgatgctctcagtgccgcgtcgccaaatactgtagtgctaagtgtcagaaaaaagcttgg
ccagaccacaagcgggaatgcaaatgccttaaaagctgcaaacccagatatcctccagac
tccgttcgacttcttggcagagttgtcttcaaacttatggatggagcaccttcagaatca
gagaagctttactcattttatgatctggagtcaaatattaacaaactgactgaagataag
aaagagggcctcaggcaactcgtaatgacatttcaacatttcatgagagaagaaatacag
gatgcctctcagctgccacctgcctttgacctttttgaagcctttgcaaaagtgatctgc
aactctttcaccatctgtaatgcggagatgcaggaagttggtgttggcctatatcccagt
atctctttgctcaatcacagctgtgaccccaactgttcgattgtgttcaatgggccccac
ctcttactgcgagcagtccgagacatcgaggtgggagaggagctcaccatctgctacctg
gatatgctgatgaccagtgaggagcgccggaagcagctgagggaccagtactgctttgaa
tgtgactgtttccgttgccaaacccaggacaaggatgctgatatgctaactggtgatgag
caagtatggaaggaagttcaagaatccctgaaaaaaattgaagaactgaaggcacactgg
aagtgggagcaggttctggccatgtgccaggcaatcataagcagcaattctgaacggctt
cccgatatcaacatctaccagctgaaggtgctcgactgcgccatggatgcctgcatcaac
ctcggcctgttggaggaagccttgttctatggtactcggaccatggagccatacaggatt
tttttcccaggaagccatcccgtcagaggggttcaagtgatgaaagttggcaaactgcag
ctacatcaaggcatgtttccccaagcaatgaagaatctgagactggcttttgatattatg
agagtgacacatggcagagaacacagcctgattgaagatttgattctacttttagaagaa
tgcgacgccaacatcagagcatcctaa

DBGET integrated database retrieval system