KEGG   Homo sapiens (human): 64755Help
Entry
64755             CDS       T01001                                 

Gene name
C16orf58, RUS
Definition
(RefSeq) chromosome 16 open reading frame 58
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: DUF647 TetR_C_28
Motif
Other DBs
NCBI-GeneID: 64755
NCBI-ProteinID: NP_073581
HGNC: 25848
Ensembl: ENSG00000140688
Vega: OTTHUMG00000132466
Pharos: Q96GQ5(Tdark)
UniProt: Q96GQ5 A0A024QZE6
Position
16p11.2
AA seq 468 aa AA seqDB search
MADDAGLETPLCSEQFGSGEARGCRAAADGSLQWEVGGWRWWGLSRAFTVKPEGRDAGEV
GASGAPSPPLSGLQAVFLPQGFPDSVSPDYLPYQLWDSVQAFASSLSGSLATQAVLLGIG
VGNAKATVSAATATWLVKDSTGMLGRIVFAWWKGSKLDCNAKQWRLFADILNDVAMFLEI
MAPVYPICFTMTVSTSNLAKCIVSVAGGATRAALTVHQARRNNMADVSAKDSSQETLVNL
AGLLVSLLMLPLVSGCPGFSLGCFFFLTALHIYANYRAVRALVMETLNEGRLRLVLKHYL
QRGEVLDPTAANRMEPLWTGFWPAPSLSLGVPLHRLVSSVFELQQLVEGHQESYLLCWDQ
SQNQVQVVLNQKAGPKTILRAATHGLMLGALQGDGPLPAELEELRNRVRAGPKKESWVVV
KETHEVLDMLFPKFLKGLQDAGWKTEKHQLEVDEWRATWLLSPEKKVL
NT seq 1407 nt NT seq  +upstreamnt  +downstreamnt
atggctgacgacgcgggtttggagaccccgctgtgttccgagcagttcggctccggggag
gcacggggctgccgcgccgccgcggacgggagcctgcagtgggaggtcgggggctggcgc
tggtgggggctctccagggccttcacggtcaaacctgaaggacgagatgcgggcgaagtg
ggggcttccggggccccctcaccgcccctctccgggctccaggccgtgttcctgcctcag
ggcttccctgatagcgtcagcccggactacttgccctaccagctgtgggattccgtgcag
gcgtttgcttccagcctctccggctccctagccacccaggcagtcttgctgggcataggg
gtggggaacgcaaaagccactgtttcagctgccacggccacctggctcgtgaaagattca
actggcatgctgggccgcatcgtctttgcctggtggaaagggagcaaactggactgcaat
gccaagcagtggaggctttttgcggacatcctcaatgacgtagccatgttccttgagatt
atggctcctgtatacccaatctgtttcaccatgaccgtctccaccagcaacctagccaag
tgcatcgtgagtgttgctggtggggccactcgggctgccctgaccgtgcaccaggctcgg
aggaacaacatggctgacgtgtcagccaaggacagcagccaggagacgctggtgaacctg
gcggggctcttggtcagcctcctgatgctccctctggtgtcaggttgccctggcttcagc
cttggatgtttcttcttcctcactgccctccacatctacgccaactaccgcgcggtccga
gccctggtcatggagaccttgaacgaaggccggctccggctggtcctgaagcactacctt
cagaggggagaggtactcgacccaactgcagccaatcgcatggagccgctgtggacaggt
ttctggccagctccgtctctatccctgggggtccccttacaccgcttggtctccagtgtc
tttgagctgcagcagctggttgaggggcaccaagaatcctacctcctctgctgggaccag
tcacaaaaccaggtacaggtagttctgaaccagaaggcaggccccaagaccatcctaagg
gccgccacacatgggctgatgcttggggccctgcagggagatggaccccttccagcagag
ctggaggagctgaggaaccgggtgcgggcaggtcctaagaaagagagctgggtcgtcgtc
aaggagacacacgaagtgttggacatgctgttcccaaagttcttgaaaggactgcaggat
gccggctggaagaccgagaagcaccagctagaggtggatgagtggagggccacatggctt
ctgtctcccgaaaagaaggtcttgtga

DBGET integrated database retrieval system