KEGG   Homo sapiens (human): 64755
Entry
64755             CDS       T01001                                 
Symbol
RUSF1, C16orf58, RUS
Name
(RefSeq) RUS family member 1
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: UVB_sens_prot TetR_C_28
Other DBs
NCBI-GeneID: 64755
NCBI-ProteinID: NP_073581
HGNC: 25848
Ensembl: ENSG00000140688
Pharos: Q96GQ5(Tdark)
UniProt: Q96GQ5 A0A024QZE6
Position
16:complement(31489475..31508391)
AA seq 468 aa
MADDAGLETPLCSEQFGSGEARGCRAAADGSLQWEVGGWRWWGLSRAFTVKPEGRDAGEV
GASGAPSPPLSGLQAVFLPQGFPDSVSPDYLPYQLWDSVQAFASSLSGSLATQAVLLGIG
VGNAKATVSAATATWLVKDSTGMLGRIVFAWWKGSKLDCNAKQWRLFADILNDVAMFLEI
MAPVYPICFTMTVSTSNLAKCIVSVAGGATRAALTVHQARRNNMADVSAKDSSQETLVNL
AGLLVSLLMLPLVSGCPGFSLGCFFFLTALHIYANYRAVRALVMETLNEGRLRLVLKHYL
QRGEVLDPTAANRMEPLWTGFWPAPSLSLGVPLHRLVSSVFELQQLVEGHQESYLLCWDQ
SQNQVQVVLNQKAGPKTILRAATHGLMLGALQGDGPLPAELEELRNRVRAGPKKESWVVV
KETHEVLDMLFPKFLKGLQDAGWKTEKHQLEVDEWRATWLLSPEKKVL
NT seq 1407 nt   +upstreamnt  +downstreamnt
atggctgacgacgcgggtttggagaccccgctgtgttccgagcagttcggctccggggag
gcacggggctgccgcgccgccgcggacgggagcctgcagtgggaggtcgggggctggcgc
tggtgggggctctccagggccttcacggtcaaacctgaaggacgagatgcgggcgaagtg
ggggcttccggggccccctcaccgcccctctccgggctccaggccgtgttcctgcctcag
ggcttccctgatagcgtcagcccggactacttgccctaccagctgtgggattccgtgcag
gcgtttgcttccagcctctccggctccctagccacccaggcagtcttgctgggcataggg
gtggggaacgcaaaagccactgtttcagctgccacggccacctggctcgtgaaagattca
actggcatgctgggccgcatcgtctttgcctggtggaaagggagcaaactggactgcaat
gccaagcagtggaggctttttgcggacatcctcaatgacgtagccatgttccttgagatt
atggctcctgtatacccaatctgtttcaccatgaccgtctccaccagcaacctagccaag
tgcatcgtgagtgttgctggtggggccactcgggctgccctgaccgtgcaccaggctcgg
aggaacaacatggctgacgtgtcagccaaggacagcagccaggagacgctggtgaacctg
gcggggctcttggtcagcctcctgatgctccctctggtgtcaggttgccctggcttcagc
cttggatgtttcttcttcctcactgccctccacatctacgccaactaccgcgcggtccga
gccctggtcatggagaccttgaacgaaggccggctccggctggtcctgaagcactacctt
cagaggggagaggtactcgacccaactgcagccaatcgcatggagccgctgtggacaggt
ttctggccagctccgtctctatccctgggggtccccttacaccgcttggtctccagtgtc
tttgagctgcagcagctggttgaggggcaccaagaatcctacctcctctgctgggaccag
tcacaaaaccaggtacaggtagttctgaaccagaaggcaggccccaagaccatcctaagg
gccgccacacatgggctgatgcttggggccctgcagggagatggaccccttccagcagag
ctggaggagctgaggaaccgggtgcgggcaggtcctaagaaagagagctgggtcgtcgtc
aaggagacacacgaagtgttggacatgctgttcccaaagttcttgaaaggactgcaggat
gccggctggaagaccgagaagcaccagctagaggtggatgagtggagggccacatggctt
ctgtctcccgaaaagaaggtcttgtga

DBGET integrated database retrieval system