KEGG   Homo sapiens (human): 64756
Entry
64756             CDS       T01001                                 
Symbol
ATPAF1, ATP11, ATP11p
Name
(RefSeq) ATP synthase mitochondrial F1 complex assembly factor 1
  KO
K07555  ATP synthase mitochondrial F1 complex assembly factor 1
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:hsa03029]
    64756 (ATPAF1)
Mitochondrial biogenesis [BR:hsa03029]
 Mitochondrial quality control factors
  Mitochondrial respiratory chain complex assembly factors
   Complex-V assembly factors
    64756 (ATPAF1)
SSDB
Motif
Pfam: ATP11
Other DBs
NCBI-GeneID: 64756
NCBI-ProteinID: NP_073582
OMIM: 608917
HGNC: 18803
Ensembl: ENSG00000123472
Pharos: Q5TC12(Tdark)
UniProt: Q5TC12 I3L448
Position
1:complement(46632737..46668557)
AA seq 351 aa
MERARGPRAEADAPEEEEEAGAAMAAVVVAAAGGAGPAVLQVAGLYRGLCAVRSRALGLG
LVSPAQLRVFPVRPGSGRPEGGADSSGVGAEAELQANPFYDRYRDKIQLLRRSDPAAFES
RLEKRSEFRKQPVGHSRQGDFIKCVEQKTDALGKQSVNRGFTKDKTLSSIFNIEMVKEKT
AEEIKQIWQQYFAAKDTVYAVIPAEKFDLIWNRAQSCPTFLCALPRREGYEFFVGQWTGT
ELHFTALINIQTRGEAAASQLILYHYPELKEEKGIVLMTAEMDSTFLNVAEAQCIANQVQ
LFYATDRKETYGLVETFNLRPNEFKYMSVIAELEQSGLGAELKCAQNQNKT
NT seq 1056 nt   +upstreamnt  +downstreamnt
atggagcgggcgcgcgggccgcgggccgaggccgacgcgcctgaggaggaggaggaggcg
ggggcggccatggctgctgtggtggtggcggctgcgggtggcgcgggaccggcggtcctg
caggtggccggtctctaccggggcctgtgcgcggtgcgcagccgcgccctgggcctgggg
ctcgtgtcacccgcgcagctgcgcgtcttcccagtgcgccccggctcgggccggcccgag
gggggcgccgacagcagcggggtcggggccgaggccgagctccaggccaaccctttctac
gaccgctaccgcgacaagatccagctgctgcgcaggtcagacccagctgcttttgagtcc
cgcctggagaaacgcagtgaatttcggaagcagccagtggggcattccaggcaaggtgat
tttatcaaatgtgtggaacagaagacagatgccttggggaaacagtctgtgaacagagga
ttcactaaggacaagactctcagttcaatctttaacattgagatggtaaaagaaaaaact
gcagaagaaataaaacagatttggcagcaatattttgcagcaaaagatacagtctacgca
gttattcctgcagaaaagtttgatttgatctggaaccgggctcagtcctgtccaacattt
ctatgtgctctgccaagaagggaaggttatgagttttttgtaggacaatggacaggtact
gaactccacttcactgcacttataaatattcagacccgaggggaagctgcagccagccag
ctgattttatatcactatcctgaacttaaggaagaaaagggcatagtgctgatgactgca
gaaatggattccacatttctgaatgttgctgaggcacagtgcatcgccaaccaagttcag
ctcttctacgctactgatcggaaagagacctacgggttagtggagacctttaacctcaga
ccaaatgagttcaaatatatgtctgtcatcgctgaattggagcaaagcggacttggagca
gaactgaaatgtgcccagaaccaaaataagacttag

DBGET integrated database retrieval system