KEGG   Homo sapiens (human): 6476Help
Entry
6476              CDS       T01001                                 

Gene name
SI
Definition
(RefSeq) sucrase-isomaltase
  KO
K01203  sucrase-isomaltase [EC:3.2.1.48 3.2.1.10]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00052  Galactose metabolism
hsa00500  Starch and sucrose metabolism
hsa01100  Metabolic pathways
hsa04973  Carbohydrate digestion and absorption
Disease
H00115  Congenital sucrase-isomaltase deficiency
Drug target
Camiglibose: D03342
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    6476 (SI)
   00500 Starch and sucrose metabolism
    6476 (SI)
 09150 Organismal Systems
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    6476 (SI)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    6476 (SI)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.10  oligo-1,6-glucosidase
     6476 (SI)
    3.2.1.48  sucrose alpha-glucosidase
     6476 (SI)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   6476 (SI)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Trefoil Gal_mutarotas_2 DUF5110
Motif
Other DBs
NCBI-GeneID: 6476
NCBI-ProteinID: NP_001032
OMIM: 609845
HGNC: 10856
Ensembl: ENSG00000090402
Vega: OTTHUMG00000158065
Pharos: P14410(Tchem)
UniProt: P14410
Structure
PDB: 

Position
3q26.1
AA seq 1827 aa AA seqDB search
MARKKFSGLEISLIVLFVIVTIIAIALIVVLATKTPAVDEISDSTSTPATTRVTTNPSDS
GKCPNVLNDPVNVRINCIPEQFPTEGICAQRGCCWRPWNDSLIPWCFFVDNHGYNVQDMT
TTSIGVEAKLNRIPSPTLFGNDINSVLFTTQNQTPNRFRFKITDPNNRRYEVPHQYVKEF
TGPTVSDTLYDVKVAQNPFSIQVIRKSNGKTLFDTSIGPLVYSDQYLQISTRLPSDYIYG
IGEQVHKRFRHDLSWKTWPIFTRDQLPGDNNNNLYGHQTFFMCIEDTSGKSFGVFLMNSN
AMEIFIQPTPIVTYRVTGGILDFYILLGDTPEQVVQQYQQLVGLPAMPAYWNLGFQLSRW
NYKSLDVVKEVVRRNREAGIPFDTQVTDIDYMEDKKDFTYDQVAFNGLPQFVQDLHDHGQ
KYVIILDPAISIGRRANGTTYATYERGNTQHVWINESDGSTPIIGEVWPGLTVYPDFTNP
NCIDWWANECSIFHQEVQYDGLWIDMNEVSSFIQGSTKGCNVNKLNYPPFTPDILDKLMY
SKTICMDAVQNWGKQYDVHSLYGYSMAIATEQAVQKVFPNKRSFILTRSTFAGSGRHAAH
WLGDNTASWEQMEWSITGMLEFSLFGIPLVGADICGFVAETTEELCRRWMQLGAFYPFSR
NHNSDGYEHQDPAFFGQNSLLVKSSRQYLTIRYTLLPFLYTLFYKAHVFGETVARPVLHE
FYEDTNSWIEDTEFLWGPALLITPVLKQGADTVSAYIPDAIWYDYESGAKRPWRKQRVDM
YLPADKIGLHLRGGYIIPIQEPDVTTTASRKNPLGLIVALGENNTAKGDFFWDDGETKDT
IQNGNYILYTFSVSNNTLDIVCTHSSYQEGTTLAFQTVKILGLTDSVTEVRVAENNQPMN
AHSNFTYDASNQVLLIADLKLNLGRNFSVQWNQIFSENERFNCYPDADLATEQKCTQRGC
VWRTGSSLSKAPECYFPRQDNSYSVNSARYSSMGITADLQLNTANARIKLPSDPISTLRV
EVKYHKNDMLQFKIYDPQKKRYEVPVPLNIPTTPISTYEDRLYDVEIKENPFGIQIRRRS
SGRVIWDSWLPGFAFNDQFIQISTRLPSEYIYGFGEVEHTAFKRDLNWNTWGMFTRDQPP
GYKLNSYGFHPYYMALEEEGNAHGVFLLNSNAMDVTFQPTPALTYRTVGGILDFYMFLGP
TPEVATKQYHEVIGHPVMPAYWALGFQLCRYGYANTSEVRELYDAMVAANIPYDVQYTDI
DYMERQLDFTIGEAFQDLPQFVDKIRGEGMRYIIILDPAISGNETKTYPAFERGQQNDVF
VKWPNTNDICWAKVWPDLPNITIDKTLTEDEAVNASRAHVAFPDFFRTSTAEWWAREIVD
FYNEKMKFDGLWIDMNEPSSFVNGTTTNQCRNDELNYPPYFPELTKRTDGLHFRTICMEA
EQILSDGTSVLHYDVHNLYGWSQMKPTHDALQKTTGKRGIVISRSTYPTSGRWGGHWLGD
NYARWDNMDKSIIGMMEFSLFGMSYTGADICGFFNNSEYHLCTRWMQLGAFYPYSRNHNI
ANTRRQDPASWNETFAEMSRNILNIRYTLLPYFYTQMHEIHANGGTVIRPLLHEFFDEKP
TWDIFKQFLWGPAFMVTPVLEPYVQTVNAYVPNARWFDYHTGKDIGVRGQFQTFNASYDT
INLHVRGGHILPCQEPAQNTFYSRQKHMKLIVAADDNQMAQGSLFWDDGESIDTYERDLY
LSVQFNLNQTTLTSTILKRGYINKSETRLGSLHVWGKGTTPVNAVTLTYNGNKNSLPFNE
DTTNMILRIDLTTHNVTLEEPIEINWS
NT seq 5484 nt NT seq  +upstreamnt  +downstreamnt
atggcaagaaagaaatttagtggattggaaatctctctgattgtcctttttgtcatagtt
actataatagctattgccttaattgttgttttagcaactaagacacctgctgttgatgaa
attagtgattctacttcaactccagctactactcgtgtgactacaaatccttctgattca
ggaaaatgtccaaatgtgttaaatgatcctgtcaatgtgagaataaactgcattccagaa
caattcccaacagagggaatttgtgcacagagaggctgctgctggaggccgtggaatgac
tctcttattccttggtgcttcttcgttgataatcatggttataacgttcaagacatgaca
acaacaagtattggagttgaagccaaattaaacaggataccttcacctacactatttgga
aatgacatcaacagtgttctcttcacaactcaaaatcagacacccaatcgtttccggttc
aagattactgatccaaataatagaagatatgaagttcctcatcagtatgtaaaagagttt
actggacccacagtttctgatacgttgtatgatgtgaaggttgcccaaaacccatttagc
atccaagttattaggaaaagcaacggtaaaactttgtttgacaccagcattggtccctta
gtgtactctgaccagtacttacagatctcaacccgtcttccaagtgattatatttatggt
attggagaacaagttcataagagatttcgtcatgatttatcctggaaaacatggccaatt
tttactcgagaccaacttcctggtgataataataataatttatacggccatcaaacattc
tttatgtgtattgaagatacatctggaaagtcattcggtgtttttttaatgaatagcaat
gcaatggagatttttatccagcctactccaatagtaacatatagagttaccggtggcatt
ctggatttttacatccttctaggagatacaccagaacaagtagttcaacagtatcaacag
cttgttggactaccagcaatgccagcatattggaatcttggattccaactaagtcgctgg
aattataagtcactagatgtagtgaaagaagtggtaaggagaaaccgggaagctggcata
ccatttgatacacaggtcactgatattgactacatggaagacaagaaagactttacttat
gatcaagttgcgtttaacggactccctcaatttgtgcaagatttgcatgaccatggacag
aaatatgtcatcatcttggaccctgcaatttccataggtcgacgtgccaatggaacaaca
tatgcaacctatgagaggggaaacacacaacatgtgtggataaatgagtcagatggaagt
acaccaattattggagaggtatggccaggattaacagtataccctgatttcactaaccca
aactgcattgattggtgggcaaatgaatgcagtattttccatcaagaagtgcaatatgat
ggactttggattgacatgaatgaagtttccagctttattcaaggttcaacaaaaggatgt
aatgtaaacaaattgaattatccaccgtttactcctgatattcttgacaaactcatgtat
tccaaaacaatttgcatggatgctgtgcagaactggggtaaacagtatgatgttcatagc
ctctatggatacagcatggctatagccacagagcaagctgtacaaaaagtttttcctaat
aagagaagcttcattcttacccgctcaacatttgctggatctggaagacatgctgcgcat
tggttaggagacaatactgcttcatgggaacaaatggaatggtctataactggaatgctg
gagttcagtttgtttggaatacctttggttggagcagacatctgtggatttgtggctgaa
accacagaagaactttgcagaagatggatgcaacttggggcattttatccattttccaga
aaccataattctgacggatatgaacatcaggatcctgcattttttgggcagaattcactt
ttggttaaatcatcaaggcagtatttaactattcgctacaccttattacccttcctctac
actctgttttataaagcccatgtgtttggagaaacagtagcaagaccagttcttcatgag
ttttatgaggatacgaacagctggattgaggacactgagtttttgtggggccctgcatta
cttattactcctgttctaaaacagggagcagatactgtgagtgcctacatccctgatgct
atttggtatgattatgaatctggtgcaaaaaggccatggaggaaacaacgggttgatatg
tatcttccagcagacaaaataggattacatcttagaggaggttatatcatccccattcaa
gaaccagatgtaacaacaacagcaagccgtaagaatcctctaggacttatagtcgcatta
ggtgaaaacaacacagccaaaggagactttttctgggatgatggagaaactaaagataca
atacaaaatggcaactacatattatatacattttcagtttctaataacacattagatatt
gtgtgcacacattcatcatatcaggaaggaactaccttagcatttcagactgtaaaaatc
cttgggttgacagacagtgttacagaagttagagtggcggaaaataatcaaccaatgaac
gctcattccaatttcacttatgatgcttctaaccaggttctcctaattgcagatctcaaa
cttaatcttggaagaaactttagtgttcaatggaatcaaattttctcagaaaatgaaaga
tttaattgttatccagatgcagatttggcaactgaacaaaagtgcacacaacgtggctgt
gtatggagaacgggttcttctctatccaaagcacctgagtgttactttcccagacaagat
aactcttattcagtcaactcagctcgctattcatccatgggtataacagctgacctccaa
ctaaatactgcaaatgccagaataaagttaccttctgaccccatctcaactcttcgtgtg
gaggtgaaatatcacaaaaatgatatgttgcagtttaagatttatgatccccaaaagaag
agatatgaagtaccagtaccgttaaacattccaaccaccccaataagtacttatgaagac
agactttatgatgtggaaatcaaggaaaatccttttggcatccagattcgacggagaagc
agtggaagagtcatttgggattcttggctgcctggatttgcttttaatgaccagttcatt
caaatatcgactcgcctgccatcagaatatatatatggttttggggaagtggaacataca
gcatttaagcgagatctgaactggaatacttggggaatgttcacaagagaccaaccccct
ggttacaaacttaattcctatggatttcatccctattacatggctctggaagaggagggc
aatgctcatggtgttttcttactcaacagcaatgcaatggatgttacattccagccaact
cctgctctaacttaccgtacagttggagggatcttggatttttatatgtttttgggccca
actccagaagttgcaacaaagcaataccatgaagtaattggccatccagtcatgccagct
tattgggctttgggattccaattatgtcgttatggatatgcaaatacttcagaggttcgg
gaattatatgacgctatggtggctgctaacatcccctatgatgttcagtacacagacatt
gactacatggaaaggcagctagactttacaattggtgaagcattccaggaccttcctcag
tttgttgacaaaataagaggagaaggaatgagatacattattatcctggatccagcaatt
tcaggaaatgaaacaaagacttaccctgcatttgaaagaggacagcagaatgatgtcttt
gtcaaatggccaaacaccaatgacatttgttgggcaaaggtttggccagatttgcccaac
ataacaatagataaaactctaacggaagatgaagctgttaatgcttccagagctcatgta
gctttcccagatttcttcaggacttccacagcagagtggtgggccagagaaattgtggac
ttttacaatgaaaagatgaagtttgatggtttgtggattgatatgaatgagccatcaagt
tttgtaaatggaacaactactaatcaatgcagaaatgacgaactaaattatccaccttat
ttcccagaactcacaaaaagaactgatggattacatttcagaacaatttgcatggaagct
gagcagattcttagtgatggaacatcagttttgcattacgatgttcacaatctctatgga
tggtcacagatgaaacctactcatgatgcattgcagaagacaactggaaaaagagggatt
gtaatttctcgttccacgtatcctactagtggacgatggggaggacactggcttggagac
aactatgcacgatgggacaacatggacaaatcaatcattggtatgatggaatttagtctg
tttggaatgtcatatactggagcagacatctgtggttttttcaacaactcagaatatcat
ctctgtacccgctggatgcaacttggagcattttatccatactcaaggaatcacaacatt
gcaaatactagaagacaagatcccgcttcctggaatgaaacttttgctgaaatgtcaagg
aatattctaaatattagatacaccttattgccctatttttacacacaaatgcatgaaatt
catgctaatggtggcactgttatccgaccccttttgcatgagttctttgatgaaaaacca
acctgggatatattcaagcagttcttatggggtccagcatttatggttaccccagtactg
gaaccttatgttcaaactgtaaatgcctacgtccccaatgctcggtggtttgactaccat
acaggcaaagatattggcgtcagaggacaatttcaaacatttaatgcttcttatgacaca
ataaacctacatgtccgtggtggtcacatcctaccatgtcaagagccagctcaaaacaca
ttttacagtcgacaaaaacacatgaagctcattgttgctgcagatgataatcagatggca
cagggttctctgttttgggatgatggagagagtatagacacctatgaaagagacctatat
ttatctgtacaatttaatttaaaccagaccaccttaacaagcactatattgaagagaggt
tacataaataaaagtgaaacgaggcttggatcccttcatgtatgggggaaaggaactact
cctgtcaatgcagttactctaacgtataacggaaataaaaattcgcttccttttaatgaa
gacactaccaacatgatattacgtattgatctgaccacacacaatgttactctagaagaa
ccaatagaaatcaactggtcatga

DBGET integrated database retrieval system