KEGG   Homo sapiens (human): 64762
Entry
64762             CDS       T01001                                 

Gene name
GAREM1, C18orf11, FAM59A, GAREM, Gm944
Definition
(RefSeq) GRB2 associated regulator of MAPK1 subtype 1
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: CABIT SAM_1
Other DBs
NCBI-GeneID: 64762
NCBI-ProteinID: NP_001229338
OMIM: 617998
HGNC: 26136
Ensembl: ENSG00000141441
Vega: OTTHUMG00000132273
Pharos: Q9H706(Tbio)
UniProt: Q9H706
Structure
PDB: 
2DKZ

Position
18q12.1
AA seq 876 aa
MDPAPSLGCSLKDVKWSSVAVPLDLLVSTYRLPQIARLDNGECVEGLRENDYLLIHSCRQ
WTTITAHSLEEGHYVIGPKIEIPVHYAGQFKLLEQDRDIKEPVQYFNSVEEVAKAFPERV
YVMEDITFNVKVASGECNEDTEVYNITLCTGDELTLMGQAEILYAKTFKEKSRLNTIFKK
IGKLNSISKLGKGKMPCLICMNHRTNESISLPFQCKGRFSTRSPLELQMQEGEHTIRNIV
EKTRLPVNVTVPSPPPRNPYDLHFIREGHRYKFVNIQTKTVVVCCVLRNNKILPMHFPLH
LTVPKFSLPEHLVKGESWPETLVHHWLGICQEQFDIDEYSRAVRDVKTDWNEECKSPKKG
RCSGHNHVPNSLSYARDELTQSFHRLSVCVYGNNLHGNSEVNLHGCRDLGGDWAPFPHDI
LPYQDSGDSGSDYLFPEASEESAGIPGKSELPYEELWLEEGKPSHQPLTRSLSEKNRCDQ
FRGSVRSKCATSPLPIPGTLGAAVKSSDTALPPPPVPPKSEAVREECRLLNAPPVPPRSA
KPLSTSPSIPPRTVKPARQQTRSPSPTLSYYSSGLHNISVTKTDTNPSESTPVSCYPCNR
VKTDSVDLKSPFGSPSAEAVSSRLSWPNHYSGASESQTRSDFLLDPSRSYSYPRQKTPGT
PKRNCPAPFDFDGCELLASPTSPVTAEFSSSVSGCPKSASYSLESTDVKSLAAGVTKQST
SCPALPPRAPKLVEEKVASETSPLPLKIDGAEEDPKSGSPDLSEDQYFVKKGMQDIFSAS
YPFSSPLHLQLAPRSCGDGSPWQPPADLSGLSIEEVSKSLRFIGLSEDVISFFVTEKIDG
NLLVQLTEEILSEDFKLSKLQVKKIMQFINGWRPKI
NT seq 2631 nt   +upstreamnt  +downstreamnt
atggacccggcgccctcgctgggctgcagcctcaaggatgtgaagtggagctcggtggcc
gtgccgctcgacctcctggtcagcacttaccggctgccccagatcgcgcgcctggacaac
ggagagtgcgtagaagggctgcgggaaaatgactatctgctgattcattcctgccgccag
tggaccaccatcactgcccacagcttggaggagggtcactatgtcattgggccaaagata
gagattccggtacattatgcagggcaattcaagctgctggaacaagaccgagatataaag
gagccagtgcaatatttcaacagtgtggaggaggtggctaaggcatttcctgaacgcgtg
tacgtcatggaggatatcacattcaacgtgaaggttgcttcaggtgaatgcaatgaagac
actgaagtttacaacatcaccctgtgtactggggatgaactcactctaatggggcaggca
gaaatcctttatgcaaagacattcaaggaaaagtcacgactcaacacaatcttcaaaaag
attgggaagctcaattccatcagcaagctgggaaaaggcaaaatgccgtgcctcatttgt
atgaatcaccggaccaacgaaagcattagccttccattccagtgcaagggcagatttagc
acccgaagtcccctggaacttcagatgcaagagggcgaacacaccatccgcaacattgtg
gagaaaaccaggcttcctgtgaatgtgactgtgccaagccctccaccgagaaacccatac
gacctccacttcatccgtgaggggcaccgctataagtttgtgaacatccagaccaagacg
gtggtggtttgctgtgtgctgcggaacaacaagatcctccccatgcactttcctttgcac
ttgactgtccccaagttcagcctcccagaacacctggtgaagggagagagctggcccgaa
accctggtccatcactggctaggtatctgccaagaacagttcgacatcgatgagtattca
cgggctgtccgtgatgtgaaaaccgactggaatgaagaatgcaagagccccaagaagggt
cggtgctctggccacaaccacgtgcccaattcgctcagctacgcccgcgatgagctcacc
cagtccttccaccgactctcggtctgtgtgtatggcaacaatctccatggcaacagtgag
gtgaaccttcatggttgcagggacctggggggagattgggctccctttcctcatgacatc
ctgccctatcaggactctggagatagtgggagcgactaccttttcccagaagctagtgaa
gaatcagcaggcatcccgggaaagtcagaacttccctacgaagagctgtggctggaggaa
ggcaagcccagccatcagcctctcactcgctctctgagcgagaagaacagatgtgatcag
tttagaggttctgtccgatccaaatgtgcgacttctcctcttcccatccctgggactctg
ggagcagcagtgaagtcttcagatactgccctacctccacctccagtgcctcccaaatct
gaagccgtcagagaagaatgccggctcctgaacgccccacctgttccaccccgaagcgca
aagcctttgtccaccagtccctccatccctcctcgcacagtcaagccagcgcggcaacag
actcgctctcccagccccaccttgtcctactattcttcagggctacacaacatcagcgtc
actaaaactgacacaaatccttctgaaagcactcctgtttcctgctatccatgtaaccga
gtgaaaactgattctgtggacctgaaatccccgtttggaagtccttctgctgaagctgtg
tcctctcggctctcatggcctaaccattattcaggagcatcagaaagccagaccaggagt
gacttcctgctggatccaagcaggagttatagttaccctagacaaaagacgccaggcaca
ccaaagagaaactgcccagcaccttttgattttgatggctgtgagctcctggccagcccc
actagcccagtcactgcagaattcagtagcagcgtctctggttgtcccaagtcagccagc
tactctctggagagcacagatgtgaaatctcttgcagctggtgtgacaaagcagagtacg
tcatgccctgccttaccccccagggctccaaaactagtggaagagaaggtcgcctccgaa
acatctcctttgcctctgaaaattgatggtgctgaggaagaccccaagtctgggtcacca
gatctctcggaggaccagtattttgttaaaaagggcatgcaggacatcttctctgcctcc
taccctttctcatctccgctccatctccagctggcccccagatcctgtggcgacggttcc
ccatggcagccacctgctgacctatcaggactctctatagaggaagtgtccaagtcacta
cggttcattggtttgtccgaagatgtcatatcattctttgttactgaaaagattgatggg
aacctgcttgttcagctaacggaagaaatcctctcagaggatttcaaattgagcaaattg
caggtgaagaagataatgcaattcattaatggctggaggcccaaaatatag

DBGET integrated database retrieval system