KEGG   Homo sapiens (human): 64770
Entry
64770             CDS       T01001                                 
Symbol
CCDC14
Name
(RefSeq) coiled-coil domain containing 14
  KO
K16541  coiled-coil domain-containing protein 14
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    64770 (CCDC14)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Centrosome formation proteins
   Pericentriolar materials (PCM)
    Other PCM proteins
     64770 (CCDC14)
   Centrosome duplication proteins
    Other centrosome duplication proteins
     64770 (CCDC14)
SSDB
Motif
Pfam: CCDC14
Other DBs
NCBI-GeneID: 64770
NCBI-ProteinID: NP_073594
OMIM: 617147
HGNC: 25766
Ensembl: ENSG00000175455
Pharos: Q49A88(Tbio)
UniProt: Q49A88
Position
3:complement(123885176..123961229)
AA seq 864 aa
MVRSGARPGQVLSSGRHTGPAKLTNGKKATYLRKIPRFNADSGYSIHSDSESQAETVHGL
DGCASLLRDILRNEDSASSDNKKQIPNEASARSERDTSDLEQNWSLQDHYRMYSPIIYQA
LCEHVQTQMSLMNDLTSKNIPNGIPAVPCHAPSHSESQATPHSSYGLCTSTPVWSLQRPP
CPPKVHSEVQTDGNSQFASQGKTVSATCTDVLRNSFNTSPGVPCSLPKTDISAIPTLQQL
GLVNGILPQQGIHKETDLLKCIQTYLSLFRSHGKETHLDSQTHRSPTQSQPAFLATNEEK
CAREQIREATSERKDLNIHVRDTKTVKDVQKAKNVNKTAEKVRIIKYLLGELKALVAEQE
DSEIQRLITEMEACISVLPTVSGNTDIQVEIALAMQPLRSENAQLRRQLRILNQQLREQQ
KTQKPSGAVDCNLELFSLQSLNMSLQNQLEESLKSQELLQSKNEELLKVIENQKDENKKF
SSIFKDKDQTILENKQQYDIEITRIKIELEEALVNVKSSQFKLETAEKENQILGITLRQR
DAEVTRLRELTRTLQTSMAKLLSDLSVDSARCKPGNNLTKSLLNIHDKQLQHDPAPAHTS
IMSYLNKLETNYSFTHSEPLSTIKNEETIEPDKTYENVLSSRGPQNSNTRGMEEASAPGI
ISALSKQDSDEGSETMALIEDEHNLDNTIYIPFARSTPEKKSPLSKRLSPQPQIRAATTQ
LVSNSGLAVSGKENKLCTPVICSSSTKEAEDAPEKLSRASDMKDTQLLKKIKEAIGKIPA
ATKEPEEQTACHGPSGCLSNSLQVKGNTVCDGSVFTSDLMSDWSISSFSTFTSRDEQDFR
NGLAALDANIARLQKSLRTGLLEK
NT seq 2595 nt   +upstreamnt  +downstreamnt
atggtcaggtctggagctcgaccgggccaggtgttatcttcaggaaggcacactggacct
gctaaattaacaaatggaaagaaagcgacctatttaagaaaaataccacgttttaatgca
gattctggctattccatccattctgattcagaaagtcaggctgaaactgtacacgggctt
gatggttgtgcttctttgctgagggacattttgagaaatgaagattcagcatcttcagat
aataagaaacagatacctaatgaagcttctgctagaagtgaaagagacacatcagaccta
gagcaaaactggtcattgcaagatcattatagaatgtattcacccataatataccaagcc
ctctgtgagcacgtgcagactcagatgtcactgatgaatgacttgacttcaaagaacatc
cctaatggaattcctgctgtaccatgccatgctccctctcattctgaatctcaggcaact
cctcattctagttatggcttatgtacctccaccccagtctggtcacttcagcggccaccc
tgccctccaaaggttcattctgaagttcaaactgatggcaacagtcagtttgcatcacaa
ggtaaaacagtttctgcaacctgtactgatgttctacggaattcatttaataccagtcct
ggagttccatgtagcctgcccaaaactgacatatcagctattccaacattgcagcaactg
ggccttgttaatggaattctgccacaacaaggaattcataaggaaacagacctactaaaa
tgtattcaaacatatttgtctctttttcgatctcatggaaaagaaacgcatctggacagt
cagacacaccgaagccctactcagtcacaaccagctttcttggccactaatgaagaaaaa
tgtgccagagagcaaattagagaggccacaagtgaaagaaaggatttaaacatacatgtg
cgagatacaaaaacagtgaaggatgtacagaaggcaaaaaatgtgaacaagacagctgaa
aaagttagaattataaaatatttgttgggagagctcaaggccctggtagcagaacaagag
gattcagaaattcagaggttgattacagaaatggaggcatgtatatctgtacttccaaca
gtaagtggaaacacagatattcaagttgagatagcactggccatgcaaccattaagaagt
gagaatgctcagttacgaaggcagttgagaattttgaaccagcaactcagagaacaacag
aaaactcaaaaaccatctggtgctgtggattgcaaccttgaattgttttctcttcagtca
ttgaatatgtcactgcaaaatcaattggaggagtcactaaagagccaggaattactgcag
agtaaaaatgaagagctgttaaaagtgattgaaaatcagaaagatgaaaacaaaaaattt
agtagtatatttaaagacaaagatcaaactatacttgaaaataaacagcaatatgatatt
gagataacaagaataaaaattgaattggaggaagccctagtcaatgtgaaaagctcccag
tttaagttagaaactgctgaaaaggaaaaccagatattggggataacattacgtcagcgt
gatgctgaggtgactcgactaagagaattaaccagaactttacagactagcatggcaaag
cttctctccgatcttagtgtggacagtgctcgctgcaagcctgggaataaccttaccaaa
tcactcttgaacattcatgataaacaacttcaacatgacccagctcctgctcacacttcc
ataatgagctatctaaataagttagaaacaaattacagttttacacattcagagccactt
tctacaattaaaaatgaggaaaccatagagccagacaaaacctatgaaaatgttctgtcc
tccagaggccctcaaaatagtaacactaggggcatggaggaagcatctgcacctggaatt
atttctgccctttcaaaacaggattctgatgaagggagtgaaactatggctttaatagaa
gatgagcataatttggataatacaatttacattccttttgctagaagcactcctgaaaag
aaatcaccactttctaagagactatcccctcagccacaaataagagcagctacaacacag
ctagtcagcaacagcggacttgctgtctctggaaaagaaaataaactgtgtacacctgta
atctgttcctcttcaacaaaggaagcagaagatgcacctgaaaaactttccagagcatct
gatatgaaggacacacagctcctcaagaaaataaaggaagcaattggtaagatccctgct
gccaccaaggagccagaggaacaaactgcatgtcatggcccatcaggttgtcttagcaac
agccttcaagtgaaaggcaatactgtctgtgatggtagtgttttcacttctgacttgatg
tctgactggagcatctcttcgttttcaacgttcacttctcgtgatgaacaagacttcaga
aatggccttgcggcattagatgccaacatagctagactccagaagtctttaaggactggt
cttctggagaaatga

DBGET integrated database retrieval system