KEGG   Homo sapiens (human): 64772Help
Entry
64772             CDS       T01001                                 

Gene name
ENGASE
Definition
(RefSeq) endo-beta-N-acetylglucosaminidase
  KO
K01227  mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase [EC:3.2.1.96]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00511  Other glycan degradation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    64772 (ENGASE)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.96  mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase
     64772 (ENGASE)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_85
Motif
Other DBs
NCBI-GeneID: 64772
NCBI-ProteinID: NP_001036038
OMIM: 611898
HGNC: 24622
Ensembl: ENSG00000167280
Vega: OTTHUMG00000167714
Pharos: Q8NFI3(Tchem)
UniProt: Q8NFI3
Position
17q25.3
AA seq 743 aa AA seqDB search
MEAAAVTVTRSATRRRRRQLQGLAAPEAGTQEEQEDQEPRPRRRRPGRSIKDEEEETVFR
EVVSFSPDPLPVRYYDKDTTKPISFYLSSLEELLAWKPRLEDGFNVALEPLACRQPPLSS
QRPRTLLCHDMMGGYLDDRFIQGSVVQTPYAFYHWQCIDVFVYFSHHTVTIPPVGWTNTA
HRHGVCVLGTFITEWNEGGRLCEAFLAGDERSYQAVADRLVQITQFFRFDGWLINIENSL
SLAAVGNMPPFLRYLTTQLHRQVPGGLVLWYDSVVQSGQLKWQDELNQHNRVFFDSCDGF
FTNYNWREEHLERMLGQAGERRADVYVGVDVFARGNVVGGRFDTDKSLELIRKHGFSVAL
FAPGWVYECLEKKDFFQNQDKFWGRLERYLPTHSICSLPFVTSFCLGMGARRVCYGQEEA
VGPWYHLSAQEIQPLFGEHRLGGDGRGWVRTHCCLEDAWHGGSSLLVRGVIPPEVGNVAV
RLFSLQAPVPPKIYLSMVYKLEGPTDVTVALELTTGDAGSCHIGGISVLNAETSSRHSLR
PLRVPPTKLARWVGRCGRQLSGGWVQHCYEVSLRGCLLLDLLVCFSRPPGSREEESFTCR
LGEIQVVDAASLLAPLPQVQAVTISHIRWQPSASEREGPPALLQLSCTLHWSFLLSQVRC
FRIHCWGGMSDDSPGRELPRPEMPMFLGLAFATQYRIVDLLVEAAGPGQDRRMEFLVEPV
PKEGFRVPQAEWGRAVLLYSAPA
NT seq 2232 nt NT seq  +upstreamnt  +downstreamnt
atggaggccgcggcggtgacggtcacccggtcggctacacggcggcggcggcggcagctg
caggggctggcggccccggaggcggggacgcaggaggagcaggaggatcaggagccgcgg
ccgcggcggcggcggccgggaaggagcatcaaagatgaagaagaagagacagtctttcga
gaggtggtcagtttttccccggaccccctgccagttagatattatgacaaggacaccacc
aaaccaatcagcttttacttgtcttcgctggaggagctcttggcgtggaagccccgcttg
gaggatggctttaatgtggccctggagcccctggcgtgtcgccagccccctctgagcagc
cagaggccccggactttgttgtgtcatgacatgatgggcgggtacctggatgacaggttc
attcagggctcggtggtgcagactccctatgctttctaccactggcagtgcatcgacgtc
tttgtgtacttcagccaccacaccgtcaccattcccccagtgggctggaccaacactgcc
cacaggcatggggtctgcgtgctggggactttcatcacggagtggaatgaagggggaagg
ctctgtgaagccttcctggccggggatgagcgctcgtaccaggcagtggctgaccggctg
gtccagatcactcagttttttcgttttgatggctggctgatcaacatcgagaactcgctg
agtctggccgctgtggggaacatgcctcctttcctgcggtacctcaccacacagctgcac
cggcaggtcccagggggcctggtgctctggtatgacagcgtggtgcaaagtgggcagctc
aaatggcaagacgaactcaaccagcacaacagggtcttctttgattcctgcgacggcttc
ttcactaactataactggcgggaggagcacttggagcggatgctggggcaggctggggag
cgccgggctgatgtgtacgtgggcgtggatgtgtttgctcgagggaacgtggtcggaggc
cgattcgacacagacaagtcgttggagctgatccgaaagcatggcttctccgtggctttg
tttgcccccggctgggtgtatgagtgtctggagaagaaggatttcttccagaaccaggac
aagttctggggccgactggagcgttatctgcccacacatagcatctgctccttgcctttc
gtcacgtccttctgcctgggcatgggtgcacggagggtctgctatggccaggaagaggcg
gtagggccctggtaccacctgagcgcccaggagatccagcccttgtttggagaacacagg
ctgggaggggatggccggggctgggtgaggacgcactgctgcctggaggatgcctggcac
ggaggcagctccctgctcgtccggggtgtgatcccaccggaggttggaaatgtggctgtg
aggttattttccctgcaggccccagtgccacccaagatttacctgtccatggtgtataag
cttgaggggcccacggacgtcacagttgctttggagctgaccacaggggatgccggcagc
tgccacatcggtggcatctcagtgttgaacgcagaaacaagctcaagacacagcctccga
cccctccgggtgccccccaccaagctggccagatgggtgggccgctgcggccggcagctg
agtgggggctgggtccagcactgctacgaggtgagcctgcgtgggtgcctgctgctagac
ctcctcgtttgcttctcacggccgccgggtagtcgggaggaggagagcttcacctgtcgg
cttggagagatccaggtggtggacgctgccagcctgctggcccctctgccccaggtgcag
gccgtcaccatctctcacatccgctggcagccatccgcctctgagcgggaggggccccct
gctctgctccagctcagctgcaccctgcactggtccttcctcctctcacaagtccgttgc
ttccgaatccactgctggggagggatgagtgatgactctccgggcagggagctgccgagg
ccagagatgcccatgttcctggggttggcttttgccacccagtaccggatagtggacctg
ctggtggaagccgccgggcccggccaggatcgtcgcatggaatttctggtggagcctgtc
cccaaggaagggttccgggtacctcaggccgagtggggcagggcagttctgctttattca
gcccctgcatga

DBGET integrated database retrieval system