KEGG   Homo sapiens (human): 64784
Entry
64784             CDS       T01001                                 
Symbol
CRTC3, TORC-3, TORC3
Name
(RefSeq) CREB regulated transcription coactivator 3
  KO
K16334  CREB-regulated transcription coactivator 3
Organism
hsa  Homo sapiens (human)
Pathway
hsa05166  Human T-cell leukemia virus 1 infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    64784 (CRTC3)
SSDB
Motif
Pfam: TORC_M TORC_C TORC_N
Other DBs
NCBI-GeneID: 64784
NCBI-ProteinID: NP_073606
OMIM: 608986
HGNC: 26148
Ensembl: ENSG00000140577
Pharos: Q6UUV7(Tbio)
UniProt: Q6UUV7 Q8TEF4
Position
15:90529923..90645345
AA seq 619 aa
MAASPGSGSANPRKFSEKIALHTQRQAEETRAFEQLMTDLTLSRVQFQKLQQLRLTQYHG
GSLPNVSQLRSSASEFQPSFHQADNVRGTRHHGLVERPSRNRFHPLHRRSGDKPGRQFDG
SAFGANYSSQPLDESWPRQQPPWKDEKHPGFRLTSALNRTNSDSALHTSALSTKPQDPYG
GGGQSAWPAPYMGFCDGENNGHGEVASFPGPLKEENLLNVPKPLPKQLWETKEIQSLSGR
PRSCDVGGGNAFPHNGQNLGLSPFLGTLNTGGSLPDLTNLHYSTPLPASLDTTDHHFGSM
SVGNSVNNIPAAMTHLGIRSSSGLQSSRSNPSIQATLNKTVLSSSLNNHPQTSVPNASAL
HPSLRLFSLSNPSLSTTNLSGPSRRRQPPVSPLTLSPGPEAHQGFSRQLSSTSPLAPYPT
SQMVSSDRSQLSFLPTEAQAQVSPPPPYPAPQELTQPLLQQPRAPEAPAQQPQAASSLPQ
SDFQLLPAQGSSLTNFFPDVGFDQQSMRPGPAFPQQVPLVQQGSRELQDSFHLRPSPYSN
CGSLPNTILPEDSSTSLFKDLNSALAGLPEVSLNVDTPFPLEEELQIEPLSLDGLNMLSD
SSMGLLDPSVEETFRADRL
NT seq 1860 nt   +upstreamnt  +downstreamnt
atggccgcctcgccgggctcgggcagcgccaacccgcggaagttcagtgagaagatcgcg
ctgcacacgcagagacaggccgaggagacgcgggccttcgagcagctcatgaccgacctc
accctgtcgcgggttcaatttcagaagcttcagcaactgcgccttacacagtaccatgga
ggatccttaccaaatgtgagccagctgcggagcagtgcgtcagagtttcagccgtcattt
caccaagctgataatgttcggggaacccgccatcacgggctggtggagaggccatccagg
aaccgcttccaccccctccaccgaaggtctggggacaagccagggcgacaatttgatggt
agtgcttttggagccaattattcctcacagcctctggatgagagttggccaaggcagcag
cctccttggaaagacgaaaagcatcctgggttcaggctgacatctgcacttaacaggacc
aattctgattctgctcttcacacgagtgctctgagtaccaagccccaggacccctatgga
ggagggggccagtcggcctggcctgccccatacatgggtttctgtgatggtgagaataat
ggacatggggaagtagcatctttccctggcccattgaaagaagagaatctgttaaatgtt
ccgaagccactgccaaaacaactgtgggagaccaaggagattcagtccctgtcaggacgc
cctcgatcctgtgatgttggaggtggcaatgcttttccacataatggtcaaaacctaggc
ctctcacccttcttggggaccttgaacactggagggtcattgccagatctaaccaacctc
cactactcgacacccctgccagcctccctggacaccaccgaccaccactttggcagtatg
agtgtggggaatagtgtgaacaacatcccagctgctatgacccacctgggtataagaagc
tcctctggtctccagagttctcggagtaacccctccatccaagccacgctcaataagact
gtgctttcctcttccttaaataaccacccacagacatctgttcccaacgcatctgctctt
cacccttcgctccgtctgttttcccttagcaacccatctctttccaccacaaacctgagc
ggcccgtctcggcgtcggcagcctcccgtcagccctctcacgctttctcctggccctgaa
gcacatcaaggtttcagcagacagctgtcttcaaccagcccactggccccatatcctacc
tcccagatggtgtcctcagaccgaagccaactttcctttctgcccacagaagctcaagcc
caggtgtcgccgccacccccttaccctgcaccccaggagctcacccagcccctcctgcag
cagccccgcgcccctgaggcccctgcccagcagccccaggcagcctcctcactgccacag
tcagactttcagcttctcccggcccagggctcatctttgaccaacttcttcccagatgtg
ggttttgaccagcagtccatgaggccaggccctgcctttcctcaacaggtgcctctggtg
caacaaggttcccgagaactgcaggactcttttcatttgagaccaagcccgtattccaac
tgcgggagtctcccgaacaccatcctgccagaagactccagcaccagcctgttcaaagac
ctcaacagtgcgctggcaggcctgcctgaggtcagcctgaacgtggacactccatttcca
ctggaagaggagctgcagattgaacccctgagcctggacggactcaacatgttaagtgac
tccagcatgggcctgctggacccctctgttgaagagacgtttcgagctgacagactgtga

DBGET integrated database retrieval system