KEGG   Homo sapiens (human): 64793
Entry
64793             CDS       T01001                                 
Symbol
CEP85, CCDC21
Name
(RefSeq) centrosomal protein 85
  KO
K16766  centrosomal protein CEP85
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    64793 (CEP85)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Centrosome formation proteins
   Other centriole associated proteins
    64793 (CEP85)
SSDB
Motif
Pfam: ADIP
Other DBs
NCBI-GeneID: 64793
NCBI-ProteinID: NP_073615
OMIM: 618898
HGNC: 25309
Ensembl: ENSG00000130695
Pharos: Q6P2H3(Tdark)
UniProt: Q6P2H3
Structure
Position
1:26234200..26278808
AA seq 762 aa
MAMQEKYPTEGISHVTSPSSDVIQKGSSLGTEWQTPVISEPFRSRFSRCSSVADSGDTAI
GTSCSDIAEDFCSSSGSPPFQPIKSHVTIPTAHVMPSTLGTSPAKPNSTPVGPSSSKLPL
SGLAESVGMTRNGDLGAMKHSPGLSRDLMYFSGATGENGIEQSWFPAVGHERQEEARKFD
IPSMESTLNQSAMMETLYSDPHHRVRFHNPRTSTSKELYRVLPEAKKAPGSGAVFERNGP
HSNSSGVLPLGLQPAPGLSKPLPSQVWQPSPDTWHPREQSCELSTCRQQLELIRLQMEQM
QLQNGAICHHPAAFGPSLPILEPAQWISILNSNEHLLKEKELLIDKQRKHISQLEQKVRE
SELQVHSALLGRPAPFGDVCLLRLQELQRENTFLRAQFAQKTEALSREKIDLEKKLSASE
VEVQLIRESLKVALQKHSEEVKKQEERVKGRDKHINNLKKKCQKESEQNREKQQRIETLE
RYLADLPTLEDHQKQSQQLKDSELKSTELQEKVTELESLLEETQAICREKEIQLESLRQR
EAEFSSAGHSLQDKQSVEETSGEGPEVEMESWQKRYDSLQKIVEKQQQKMDQLRSQVQSL
EQEVAQEEGTSQALREEAQRRDSALQQLRTAVKELSVQNQDLIEKNLTLQEHLRQAQPGS
PPSPDTAQLALELHQELASCLQDLQAVCSIVTQRAQGHDPNLSLLLGIHSAQHPETQLDL
QKPDVIKRKLEEVQQLRRDIEDLRTTMSDRYAQDMGENCVTQ
NT seq 2289 nt   +upstreamnt  +downstreamnt
atggccatgcaggagaaatatccaactgaggggatctctcacgtcacttcaccgagttcc
gatgtgattcagaagggcagttccctggggactgaatggcagaccccagttatctcggag
ccctttcggagccgcttcagccgctgttcaagtgtagccgacagtggggacacagccatt
ggtacatcatgctcagatattgcggaggatttttgcagctcaagtggcagtcctcctttc
cagcccatcaaaagccacgtaaccattccaacagcccatgtgatgccttctactttaggg
acctctcctgccaagccaaattctacacctgttggaccctcttcctctaaactccctttg
tcagggttggctgaaagtgtgggaatgacaagaaatggagacctcggtgcaatgaaacat
tctccaggcctatctagagatctcatgtatttctctggtgctactggagaaaatggaatt
gagcagtcctggtttccagcagtgggccatgaaagacaagaagaggcgaggaagtttgat
attcctagcatggaatctaccctcaatcagtcggcaatgatggagacactttattcagat
cctcaccaccgagtccgcttccacaacccaagaaccagcacaagtaaggagttgtacaga
gtgttgcctgaggccaagaaggcaccgggcagcggggcagtgtttgagcggaatggacca
cattctaatagcagtggggtcctccctttgggactccagcctgctcccgggctctccaag
cctctgccctctcaggtgtggcagccgagtcctgacacttggcatccccgagagcaatct
tgtgaactcagcacttgtcggcagcagctggaattgattcgtttacagatggagcaaatg
cagcttcagaatggagccatctgccaccatcctgctgcttttggtccttcactgcccatc
ttagagccagcacagtggatcagcatcttgaacagtaatgaacaccttctgaaggaaaaa
gagcttctcattgacaagcagaggaaacacatctctcagctggagcagaaagtgcgagag
agcgaactgcaagtccacagtgccctcttgggccgccctgccccctttggtgatgtctgc
ttgctgaggctacaggaattgcagcgagaaaacactttcttacgtgcacagtttgcacag
aagacagaagccttgagcagagaaaagattgaccttgaaaagaaactctctgcttctgaa
gttgaagtccagctcatcagagagtcgctcaaagtggcgttgcagaagcattctgaggaa
gtgaagaaacaggaagaaagggtcaaaggtcgtgataaacatatcaataatttgaaaaag
aaatgccagaaggaatcagagcagaaccgggagaagcagcagcgtattgagaccttggag
cgctacctggctgacctgcccacactggaagaccatcagaagcagagccagcagcttaag
gattctgagttgaagagcacagagctgcaggagaaagtgactgagctggagagtttgctg
gaggagacccaggcaatctgcagagagaaggagattcaactggaaagcctgaggcagaga
gaagcagaattctcctccgctggacatagcctgcaagataaacagtctgtggaggagacc
agtggagaaggtccagaagtggaaatggagtcctggcagaagcgatacgattcgctccaa
aagattgtggagaagcagcagcagaagatggatcagttgcgctcacaagtacagagccta
gagcaggaagtggctcaagaagaaggaacaagccaggccctgagagaggaggcccagcga
agggattcagccctgcagcagctgcgcacagccgtgaaggagctttcagtgcaaaaccag
gacttgattgagaagaatctgacactccaggaacacctgcgccaggcccaaccagggtct
ccaccttcaccagacacggcccagctggcacttgagctgcaccaggagttggccagttgc
cttcaagatctgcaggctgtctgtagcattgtgacccagagggcccagggccatgacccc
aatctctccctgctcctgggcattcactcagcacagcacccagagactcagctagatttg
cagaagccagatgtgatcaagaggaaactagaagaggttcaacagctgcgtcgtgacatt
gaggacttaaggaccaccatgtcagacagatatgcccaggacatgggagaaaactgtgtc
acacagtga

DBGET integrated database retrieval system