KEGG   Homo sapiens (human): 64798Help
Entry
64798             CDS       T01001                                 

Gene name
DEPTOR, DEP.6, DEPDC6
Definition
(RefSeq) DEP domain containing MTOR interacting protein
  KO
K20402  DEP domain-containing mTOR-interacting protein
Organism
hsa  Homo sapiens (human)
Pathway
hsa04140  Autophagy - animal
hsa04150  mTOR signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04150 mTOR signaling pathway
    64798 (DEPTOR)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    64798 (DEPTOR)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    64798 (DEPTOR)
Membrane trafficking [BR:hsa04131]
 Autophagy
  Other autophagy associated proteins
   mTORC1 complex
    64798 (DEPTOR)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DEP PDZ_6 PDZ_2 PDZ Complex1_LYR_2 HTH_57
Motif
Other DBs
NCBI-GeneID: 64798
NCBI-ProteinID: NP_073620
OMIM: 612974
HGNC: 22953
Ensembl: ENSG00000155792
Vega: OTTHUMG00000165052
Pharos: Q8TB45(Tbio)
UniProt: Q8TB45
Position
8q24.12
AA seq 409 aa AA seqDB search
MEEGGSTGSAGSDSSTSGSGGAQQRELERMAEVLVTGEQLRLRLHEEKVIKDRRHHLKTY
PNCFVAKELIDWLIEHKEASDRETAIKLMQKLADRGIIHHVCDEHKEFKDVKLFYRFRKD
DGTFPLDNEVKAFMRGQRLYEKLMSPENTLLQPREEEGVKYERTFMASEFLDWLVQEGEA
TTRKEAEQLCHRLMEHGIIQHVSNKHPFVDSNLLYQFRMNFRRRRRLMELLNEKSPSSQE
THDSPFCLRKQSHDNRKSTSFMSVSPSKEIKIVSAVRRSSMSSCGSSGYFSSSPTLSSSP
PVLCNPKSVLKRPVTSEELLTPGAPYARKTFTIVGDAVGWGFVVRGSKPCHIQAVDPSGP
AAAAGMKVCQFVVSVNGLNVLHVDYRTVSNLILTGPRTIVMEVMEELEC
NT seq 1230 nt NT seq  +upstreamnt  +downstreamnt
atggaggagggcggcagcactggcagtgctggcagtgacagcagcaccagcgggagtggc
ggggcgcagcaaagggagctggagcgcatggctgaggtcttggtcaccggggaacagcta
cggctcaggctgcacgaagaaaaggttattaaagatagacgtcatcatctcaagacctac
ccaaactgttttgtcgcaaaagaactgattgactggctgattgaacacaaagaggcttct
gacagagagacggcaattaaactcatgcagaaattagcagaccggggcattattcaccat
gtgtgtgatgagcataaggaattcaaggatgtcaaactcttctaccgctttagaaaggat
gacggcaccttcccattggataatgaagtgaaggcctttatgagaggacagaggctatat
gaaaagctgatgagccctgaaaacacactcctgcagcccagggaggaggaaggggtcaag
tatgagcgcaccttcatggcatctgaattcctggactggctggttcaggaaggtgaggcc
accacgaggaaagaggcagagcagctttgccaccggcttatggagcatggcatcatccag
catgtgtccaacaagcacccatttgtggacagcaatcttctctaccagttcagaatgaac
ttccggcggaggcgaagactgatggagctgctcaatgaaaagtccccctcctcccaggaa
actcatgacagtcccttctgcctgaggaagcagagccatgacaatcggaaatctaccagc
tttatgtcagtgagccccagcaaggagatcaagatcgtgtctgcagtgaggagaagcagc
atgagcagctgtggcagcagcggctacttcagcagcagccccaccctcagcagcagcccc
cctgtgctctgcaaccccaagtccgtgctgaagagacctgtcacctctgaggaactcctt
actcccggggctccgtatgcaaggaagacattcacgattgttggtgacgcggttggctgg
ggttttgtggtgcgaggaagtaagccatgccacatccaggctgtagaccccagtggccct
gcagccgcagcaggaatgaaggtctgtcagtttgtcgtctctgtcaacgggctcaatgtc
ctgcatgtagactaccggaccgtgagcaatctgattctgacgggcccacggacgattgtc
atggaagtcatggaggagttagagtgctga

DBGET integrated database retrieval system