KEGG   Homo sapiens (human): 64805
Entry
64805             CDS       T01001                                 

Gene name
P2RY12, ADPG-R, BDPLT8, HORK3, P2T(AC), P2Y(12)R, P2Y(AC), P2Y(ADP), P2Y(cyc), P2Y12, SP1999
Definition
(RefSeq) purinergic receptor P2Y12
  KO
K04298  P2Y purinoceptor 12
Organism
hsa  Homo sapiens (human)
Pathway
hsa04611  Platelet activation
Disease
H01235  Bleeding disorder platelet-type
Drug target
Cangrelor (DG01294): D03359 D03361<US>
Clopidogrel (DG00155): D00769<JP/US> D07729 D10823 D10824
Elinogrel (DG01295): D09607 D09608
Prasugrel: D05597<JP/US>
Regrelor disodium: D08983
Ticagrelor: D09017<JP/US>
Ticlopidine (DG00156): D01028<JP> D08594
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    64805 (P2RY12)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    64805 (P2RY12)
G protein-coupled receptors [BR:hsa04030]
 Rhodopsin family
  Base and nucleoside
   Purine / pyrimidine
    64805 (P2RY12)
SSDB
Motif
Pfam: 7tm_1
Other DBs
NCBI-GeneID: 64805
NCBI-ProteinID: NP_073625
OMIM: 600515
HGNC: 18124
Ensembl: ENSG00000169313
Vega: OTTHUMG00000159863
Pharos: Q9H244(Tclin)
UniProt: Q9H244 A8K7T1
Position
3q25.1
AA seq 342 aa
MQAVDNLTSAPGNTSLCTRDYKITQVLFPLLYTVLFFVGLITNGLAMRIFFQIRSKSNFI
IFLKNTVISDLLMILTFPFKILSDAKLGTGPLRTFVCQVTSVIFYFTMYISISFLGLITI
DRYQKTTRPFKTSNPKNLLGAKILSVVIWAFMFLLSLPNMILTNRQPRDKNVKKCSFLKS
EFGLVWHEIVNYICQVIFWINFLIVIVCYTLITKELYRSYVRTRGVGKVPRKKVNVKVFI
IIAVFFICFVPFHFARIPYTLSQTRDVFDCTAENTLFYVKESTLWLTSLNACLDPFIYFF
LCKSFRNSLISMLKCPNSATSLSQDNRKKEQDGGDPNEETPM
NT seq 1029 nt   +upstreamnt  +downstreamnt
atgcaagccgtcgacaacctcacctctgcgcctggtaacaccagtctgtgcaccagagac
tacaaaatcacccaggtcctcttcccactgctctacactgtcctgttttttgttggactt
atcacaaatggcctggcgatgaggattttctttcaaatccggagtaaatcaaactttatt
atttttcttaagaacacagtcatttctgatcttctcatgattctgacttttccattcaaa
attcttagtgatgccaaactgggaacaggaccactgagaacttttgtgtgtcaagttacc
tccgtcatattttatttcacaatgtatatcagtatttcattcctgggactgataactatc
gatcgctaccagaagaccaccaggccatttaaaacatccaaccccaaaaatctcttgggg
gctaagattctctctgttgtcatctgggcattcatgttcttactctctttgcctaacatg
attctgaccaacaggcagccgagagacaagaatgtgaagaaatgctctttccttaaatca
gagttcggtctagtctggcatgaaatagtaaattacatctgtcaagtcattttctggatt
aatttcttaattgttattgtatgttatacactcattacaaaagaactgtaccggtcatac
gtaagaacgaggggtgtaggtaaagtccccaggaaaaaggtgaacgtcaaagttttcatt
atcattgctgtattctttatttgttttgttcctttccattttgcccgaattccttacacc
ctgagccaaacccgggatgtctttgactgcactgctgaaaatactctgttctatgtgaaa
gagagcactctgtggttaacttccttaaatgcatgcctggatccgttcatctattttttc
ctttgcaagtccttcagaaattccttgataagtatgctgaagtgccccaattctgcaaca
tctctgtcccaggacaataggaaaaaagaacaggatggtggtgacccaaatgaagagact
ccaatgtaa

DBGET integrated database retrieval system