KEGG   Homo sapiens (human): 64806
Entry
64806             CDS       T01001                                 

Gene name
IL25, IL17E
Definition
(RefSeq) interleukin 25
  KO
K05493  interleukin 17E
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04657  IL-17 signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    64806 (IL25)
 09150 Organismal Systems
  09151 Immune system
   04657 IL-17 signaling pathway
    64806 (IL25)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    64806 (IL25)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  Interleukins
   64806 (IL25)
SSDB
Motif
Pfam: IL17
Other DBs
NCBI-GeneID: 64806
NCBI-ProteinID: NP_073626
OMIM: 605658
HGNC: 13765
Ensembl: ENSG00000166090
Vega: OTTHUMG00000028749
Pharos: Q9H293(Tbio)
UniProt: Q9H293
Position
14q11.2
AA seq 177 aa
MRERPRLGEDSSLISLFLQVVAFLAMVMGTHTYSHWPSCCPSKGQDTSEELLRWSTVPVP
PLEPARPNRHPESCRASEDGPLNSRAISPWRYELDRDLNRLPQDLYHARCLCPHCVSLQT
GSHMDPRGNSELLYHNQTVFYRRPCHGEKGTHKGYCLERRLYRVSLACVCVRPRVMG
NT seq 534 nt   +upstreamnt  +downstreamnt
atgagggagcgacccagattaggtgaggacagttctctcattagccttttcctacaggtg
gttgcattcttggcaatggtcatgggaacccacacctacagccactggcccagctgctgc
cccagcaaagggcaggacacctctgaggagctgctgaggtggagcactgtgcctgtgcct
cccctagagcctgctaggcccaaccgccacccagagtcctgtagggccagtgaagatgga
cccctcaacagcagggccatctccccctggagatatgagttggacagagacttgaaccgg
ctcccccaggacctgtaccacgcccgttgcctgtgcccgcactgcgtcagcctacagaca
ggctcccacatggacccccggggcaactcggagctgctctaccacaaccagactgtcttc
taccggcggccatgccatggcgagaagggcacccacaagggctactgcctggagcgcagg
ctgtaccgtgtttccttagcttgtgtgtgtgtgcggccccgtgtgatgggctag

DBGET integrated database retrieval system