KEGG   Homo sapiens (human): 64839Help
Entry
64839             CDS       T01001                                 

Gene name
FBXL17, FBXO13, Fbl17, Fbx13
Definition
(RefSeq) F-box and leucine rich repeat protein 17
  KO
K10283  F-box and leucine-rich repeat protein 17
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:hsa04121]
    64839 (FBXL17)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   SCF complex
    Target recognizing subunit (F-box)
     64839 (FBXL17)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: F-box-like LRR_6 F-box LRR_4
Motif
Other DBs
NCBI-GeneID: 64839
NCBI-ProteinID: NP_001156787
OMIM: 609083
HGNC: 13615
Ensembl: ENSG00000145743
Pharos: Q9UF56(Tbio)
UniProt: Q9UF56
Position
5q21.3
AA seq 701 aa AA seqDB search
MGHLLSKEPRNRPSQKRPRCCSWCRRRRPLLRLPRRTPAKVPPQPAAPRSRDCFFRGPCM
LCFIVHSPGAPAPAGPEEEPPLSPPPRDGAYAAASSSQHLARRYAALAAEDCAAAARRFL
LSSAAAAAAAAASASSPASCCKELGLAAAAAWEQQGRSLFLASLGPVRFLGPPAAVQLFR
GPTPSPAELPTPPEMVCKRKGAGVPACTPCKQPRCGGGGCGGGGGGGGGGGPAGGGASPP
RPPDAGCCQAPEQPPQPLCPPPSSPTSEGAPTEAGGDAVRAGGTAPLSAQQQHECGDADC
RESPENPCDCHREPPPETPDINQLPPSILLKIFSNLSLDERCLSASLVCKYWRDLCLDFQ
FWKQLDLSSRQQVTDELLEKIASRSQNIIEINISDCRSMSDNGVCVLAFKCPGLLRYTAY
RCKQLSDTSIIAVASHCPLLQKVHVGNQDKLTDEGLKQLGSKCRELKDIHFGQCYKISDE
GMIVIAKGCLKLQRIYMQENKLVTDQSVKAFAEHCPELQYVGFMGCSVTSKGVIHLTKLR
NLSSLDLRHITELDNETVMEIVKRCKNLSSLNLCLNWIINDRCVEVIAKEGQNLKELYLV
SCKITDYALIAIGRYSMTIETVDVGWCKEITDQGATLIAQSSKSLRYLGLMRCDKVNEVT
VEQLVQQYPHITFSTVLQDCKRTLERAYQMGWTPNMSAASS
NT seq 2106 nt NT seq  +upstreamnt  +downstreamnt
atgggccaccttctctcgaaggagccgcgtaaccgcccgagccagaagaggcctcgctgt
tgcagttggtgccgccgccggcgccctctcctcaggctgccccgccggaccccagccaag
gtgccccctcagccggcggcgccccggagccgggactgcttcttccgcgggccctgcatg
ctctgcttcatcgtgcacagtcccggcgcgcccgcccccgccggcccagaggaggagccg
ccgctctcgccgccgccgcgggacggggcctacgctgccgcctcctcctctcagcacctg
gcgcggcgctacgcggccctggccgccgaggactgcgccgctgctgcccgccgcttcctg
ctatcctcggccgccgccgccgccgccgctgccgcctcggcttcgtcgcccgcctcctgc
tgcaaagagttggggctggctgcggccgccgcctgggagcagcagggccgaagtctcttc
ctggccagcttggggccggtgcgcttcctggggccgcccgccgccgtgcagctcttccgg
gggccgacaccgtcaccggccgagctccctacgccccccgaaatggtgtgcaagcggaag
ggggccggggtccccgcctgcaccccctgcaagcagccccgctgcggcggcgggggctgc
ggcggcggcggcggcggcggtggcgggggagggcctgcggggggaggcgcttcgccgccc
cggccccccgacgccggctgctgccaggccccggagcagcccccgcagccgctctgccct
ccgccctcttctcccacctccgaaggtgcccccaccgaagctggcggggacgctgtccga
gccgggggcaccgcccccttgtccgcccagcagcagcatgaatgtggcgacgcggactgt
cgggagtcccccgaaaacccctgcgactgtcacagggagccgccccccgaaaccccagac
atcaaccagctgccgccgtccatcctgctcaagatattttccaatttgtcactggatgag
cgttgcctttccgcatcattggtttgcaagtactggcgtgacctttgtttagacttccag
ttttggaagcagctggatcttagtagtcgtcagcaggtcactgatgaattgttggaaaaa
attgcatcaagaagtcagaatataattgaaatcaacatttctgattgtcgcagtatgtct
gataatggcgtatgtgttttagcatttaaatgtcctggacttcttaggtatacagcctac
aggtgtaaacagctttctgacacctctattattgcggttgcctctcactgtcctttactt
cagaaagtgcatgtaggcaaccaggacaaactcactgatgaaggactcaagcagctgggc
tcaaaatgcagagaactcaaagatattcatttcggccagtgttacaagatctcagatgaa
ggcatgatcgtcatagctaagggctgtctgaaattacaaaggatatacatgcaggaaaac
aaattagtgacagatcagtcagtgaaagcatttgctgaacactgtcctgagcttcaatat
gtaggcttcatgggttgttcagtcacttctaaaggagtcattcacctaaccaagctaaga
aacctttccagcttggacctacgtcatatcactgaactggataatgaaaccgtgatggaa
attgtcaagaggtgcaaaaatcttagctctctcaatctctgtctgaactggatcataaat
gacaggtgtgtggaggtcattgcaaaggaaggacaaaacctgaaagagctatatttggtg
tcctgtaaaatcacagattatgcactgatagccattgggcgatacagcatgacaatagag
actgtggatgtcggatggtgtaaagaaatcacagaccaaggagccaccctgattgcacag
agcagcaagtctctgagatatttggggctgatgagatgtgataaagtcaacgaagtgacg
gtggaacagctggtgcagcagtacccccacatcaccttcagcaccgtcctgcaggactgc
aagaggaccttggagagagcctatcagatgggctggacccccaacatgtctgccgcctcc
tcctag

DBGET integrated database retrieval system