KEGG   Homo sapiens (human): 64840Help
Entry
64840             CDS       T01001                                 

Gene name
PORCN, DHOF, FODH, MG61, PORC, PPN
Definition
(RefSeq) porcupine O-acyltransferase
  KO
K00181  O-palmitoleoyl transferase [EC:2.3.1.250]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04310  Wnt signaling pathway
Disease
H00949  Focal dermal hypoplasia
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    64840 (PORCN)
Enzymes [BR:hsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.250  [Wnt protein] O-palmitoleoyl transferase
     64840 (PORCN)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MBOAT
Motif
Other DBs
NCBI-GeneID: 64840
NCBI-ProteinID: NP_982301
OMIM: 300651
HGNC: 17652
Ensembl: ENSG00000102312
Vega: OTTHUMG00000024116
Pharos: Q9H237(Tbio)
UniProt: Q9H237
Position
Xp11.23
AA seq 461 aa AA seqDB search
MATFSRQEFFQQLLQGCLLPTAQQGLDQIWLLLAICLACRLLWRLGLPSYLKHASTVAGG
FFSLYHFFQLHMVWVVLLSLLCYLVLFLCRHSSHRGVFLSVTILIYLLMGEMHMVDTVTW
HKMRGAQMIVAMKAVSLGFDLDRGEVGTVPSPVEFMGYLYFVGTIVFGPWISFHSYLQAV
QGRPLSCRWLQKVARSLALALLCLVLSTCVGPYLFPYFIPLNGDRLLRNKKRKARGTMVR
WLRAYESAVSFHFSNYFVGFLSEATATLAGAGFTEEKDHLEWDLTVSKPLNVELPRSMVE
VVTSWNLPMSYWLNNYVFKNALRLGTFSAVLVTYAASALLHGFSFHLAAVLLSLAFITYV
EHVLRKRLARILSACVLSKRCPPDCSHQHRLGLGVRALNLLFGALAIFHLAYLGSLFDVD
VDDTTEEQGYGMAYTVHKWSELSWASHWVTFGCWIFYRLIG
NT seq 1386 nt NT seq  +upstreamnt  +downstreamnt
atggccacctttagccgccaggaatttttccagcagctactgcaaggctgtctcctgcct
actgcccagcagggccttgaccagatctggctgctccttgccatctgcctcgcctgccgc
ctcctctggaggctcgggttgccatcctacctgaagcatgcaagcaccgtggcaggcggg
ttcttcagcctctaccacttcttccagctgcacatggtttgggtcgtgctgctcagcctc
ctgtgctacctcgtgctgttcctctgccgacattcctcccatcgaggcgtcttcctatcc
gtcaccatcctcatctacctactcatgggtgagatgcacatggtagacaccgtgacatgg
cacaagatgcgaggggcacagatgattgtggccatgaaggcagtgtctctgggcttcgac
ctggaccggggcgaggtgggtacggtgccctcgccagtggagttcatgggctacctctac
ttcgtgggcaccatcgtcttcgggccctggatatccttccacagctacctacaagctgtc
caaggccgcccactgagctgccggtggctgcagaaggtggcccggagcctggcactggcc
ctgctgtgccttgtgctgtccacttgcgtgggcccctacctcttcccgtacttcatcccc
ctcaacggtgaccgcctccttcgcaacaagaaacgcaaagccaggggcaccatggtaagg
tggctgcgagcctacgagagtgctgtctccttccacttcagcaactattttgtgggcttt
ctttccgaggccacggccacgttggcgggggctggctttaccgaggagaaggatcacctg
gaatgggacctgacggtgtccaagccactgaatgtggagctgcctcggtcaatggtggaa
gttgtcacaagctggaacctgcccatgtcttattggctaaataactatgttttcaagaat
gctctccgcctggggaccttctcggctgtgctggtcacctatgcagccagcgccctccta
catggcttcagtttccacctggctgcggtcctgctgtccctggcttttatcacttacgtg
gagcatgtcctccggaagcgcctggctcggatcctcagtgcctgtgtcttgtcaaagcgg
tgcccgccagactgttcgcaccagcatcgcttgggcctgggggtgcgagccttaaacttg
ctctttggagctctggccatcttccacctggcctacctgggctccctgtttgatgtcgat
gtggatgacaccacagaggagcagggctacggcatggcatacactgtccacaagtggtca
gagctcagctgggccagtcactgggtcacttttggatgctggatcttctaccgtctcata
ggctga

DBGET integrated database retrieval system