KEGG   Homo sapiens (human): 64849
Entry
64849             CDS       T01001                                 

Gene name
SLC13A3, ARLIAK, NADC3, SDCT2
Definition
(RefSeq) solute carrier family 13 member 3
  KO
K14445  solute carrier family 13 (sodium-dependent dicarboxylate transporter), member 2/3/5
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    64849 (SLC13A3)
Transporters [BR:hsa02000]
 Solute carrier family (SLC)
  SLC13: Human Na+-sulfate/carboxylate cotransporter
   64849 (SLC13A3)
SSDB
Motif
Pfam: Na_sulph_symp CitMHS
Other DBs
NCBI-GeneID: 64849
NCBI-ProteinID: NP_073740
OMIM: 606411
HGNC: 14430
Ensembl: ENSG00000158296
Vega: OTTHUMG00000033042
Pharos: Q8WWT9(Tbio)
UniProt: Q8WWT9
Position
20q13.12
AA seq 602 aa
MAALAAAAKKVWSARRLLVLLFTPLALLPVVFALPPKEGRCLFVILLMAVYWCTEALPLS
VTALLPIVLFPFMGILPSNKVCPQYFLDTNFLFLSGLIMASAIEEWNLHRRIALKILMLV
GVQPARLILGMMVTTSFLSMWLSNTASTAMMLPIANAILKSLFGQKEVRKDPSQESEENT
AAVRRNGLHTVPTEMQFLASTEAKDHPGETEVPLDLPADSRKEDEYRRNIWKGFLISIPY
SASIGGTATLTGTAPNLILLGQLKSFFPQCDVVNFGSWFIFAFPLMLLFLLAGWLWISFL
YGGLSFRGWRKNKSEIRTNAEDRARAVIREEYQNLGPIKFAEQAVFILFCMFAILLFTRD
PKFIPGWASLFNPGFLSDAVTGVAIVTILFFFPSQRPSLKWWFDFKAPNTETEPLLTWKK
AQETVPWNIILLLGGGFAMAKGCEESGLSVWIGGQLHPLENVPPALAVLLITVVIAFFTE
FASNTATIIIFLPVLAELAIRLRVHPLYLMIPGTVGCSFAFMLPVSTPPNSIAFASGHLL
VKDMVRTGLLMNLMGVLLLSLAMNTWAQTIFQLGTFPDWADMYSVNVTALPPTLANDTFR
TL
NT seq 1809 nt   +upstreamnt  +downstreamnt
atggcggcgctggcagcagcggccaagaaggtgtggagcgcgcggcggctgctggtgctg
ctgttcacgccgctcgcgctgctgccggtggtcttcgccctcccgcccaaggaaggccgc
tgcttgtttgtcatcctgctcatggcggtgtactggtgcacggaggccctgccgctctca
gtgacggcgctgctgcccatcgtcctcttccccttcatgggcatcttgccctccaacaag
gtctgcccccagtacttcctcgacaccaacttcctcttcctcagtgggctgatcatggcc
agcgccattgaggagtggaacctgcaccggcgaatcgccctcaagatcctgatgcttgtt
ggagtccagccggccaggctcatcctggggatgatggtgaccacctcgttcttgtccatg
tggctgagcaacaccgcctccactgccatgatgcttcccattgccaatgccatcctgaaa
agtctctttggccagaaggaggttcgaaaggaccccagccaggagagtgaagagaacaca
gctgctgtgcggagaaacggcctacacactgtgcccacggagatgcagtttctcgccagc
acagaagccaaagaccaccctggggagacagaggttccactggatctgccggctgactcc
aggaaggaggatgaatatcgtcggaacatctggaagggcttcctcatctccatcccctac
tcagccagtattgggggcacagccacactcacgggcacagcccctaacctcatcctgctt
ggccagctcaagagtttctttccgcagtgtgacgtggtgaatttcggctcctggttcatt
ttcgccttccctcttatgctgttgttcctgttggcaggctggctctggatctccttcctg
tacgggggactgagcttcaggggctggaggaagaataaatctgagataagaaccaatgca
gaagatagggctcgagctgtaattcgggaagaataccagaacctggggcccatcaagttt
gccgaacaggctgttttcatccttttctgcatgtttgccatcctcctcttcacccgggac
ccgaagttcatccctggctgggccagcctcttcaatcctgggtttctttctgatgctgtc
accggcgtggctattgtcaccatcttgttcttcttcccgtcccaaaggccctctctcaag
tggtggtttgacttcaaagctcccaacacagagacagagcccttgctgacctggaagaag
gcccaggagacagtgccctggaacatcatccttctcctgggagggggcttcgccatggcc
aaaggctgtgaggaatcggggctgtctgtatggattggtgggcagctgcaccccctggag
aatgtgccccccgccctggctgtgctgctcatcactgtggtcatcgccttcttcactgag
tttgccagcaacacggcgaccatcatcatcttcctgccggtcctggcagagctggccatc
cgcctgagagtgcaccccctgtatctgatgattccgggcacagtcggctgctcctttgcc
ttcatgctcccggtctcaacgccccccaactccatcgccttcgcctctggacacttgctg
gtcaaagacatggtgcggacaggcctcctgatgaacctgatgggtgtcctgctgctcagt
ttggctatgaatacctgggcacagaccatcttccagctgggcaccttcccggactgggct
gatatgtactcggtcaatgtcacagcattgccacccaccttggccaatgacacatttcgg
accctctga

DBGET integrated database retrieval system