KEGG   Homo sapiens (human): 64855Help
Entry
64855             CDS       T01001                                 

Gene name
NIBAN2, C9orf88, FAM129B, MEG-3, MINERVA, OC58, bA356B19.6
Definition
(RefSeq) niban apoptosis regulator 2
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: PH
Motif
Other DBs
NCBI-GeneID: 64855
NCBI-ProteinID: NP_073744
OMIM: 614045
HGNC: 25282
Ensembl: ENSG00000136830
Vega: OTTHUMG00000020705
Pharos: Q96TA1(Tdark)
UniProt: Q96TA1
Position
9q34.11
AA seq 746 aa AA seqDB search
MGDVLSTHLDDARRQHIAEKTGKILTEFLQFYEDQYGVALFNSMRHEIEGTGLPQAQLLW
RKVPLDERIVFSGNLFQHQEDSKKWRNRFSLVPHNYGLVLYENKAAYERQVPPRAVINSA
GYKILTSVDQYLELIGNSLPGTTAKSGSAPILKCPTQFPLILWHPYARHYYFCMMTEAEQ
DKWQAVLQDCIRHCNNGIPEDSKVEGPAFTDAIRMYRQSKELYGTWEMLCGNEVQILSNL
VMEELGPELKAELGPRLKGKPQERQRQWIQISDAVYHMVYEQAKARFEEVLSKVQQVQPA
MQAVIRTDMDQIITSKEHLASKIRAFILPKAEVCVRNHVQPYIPSILEALMVPTSQGFTE
VRDVFFKEVTDMNLNVINEGGIDKLGEYMEKLSRLAYHPLKMQSCYEKMESLRLDGLQQR
FDVSSTSVFKQRAQIHMREQMDNAVYTFETLLHQELGKGPTKEELCKSIQRVLERVLKKY
DYDSSSVRKRFFREALLQISIPFLLKKLAPTCKSELPRFQELIFEDFARFILVENTYEEV
VLQTVMKDILQAVKEAAVQRKHNLYRDSMVMHNSDPNLHLLAEGAPIDWGEEYSNSGGGG
SPSPSTPESATLSEKRRRAKQVVSVVQDEEVGLPFEASPESPPPASPDGVTEIRGLLAQG
LRPESPPPAGPLLNGAPAGESPQPKAAPEASSPPASPLQHLLPGKAVDLGPPKPSDQETG
EQVSSPSSHPALHTTTEDSAGVQTEF
NT seq 2241 nt NT seq  +upstreamnt  +downstreamnt
atgggggacgtgctgtccacgcacctggacgacgcccggcgccagcacatcgcagaaaaa
accgggaagatcctgacggagttcctccagttctatgaagaccagtatggcgtggctctc
ttcaacagcatgcgccatgagattgagggcacggggctgccgcaggcccagctgctctgg
cgcaaggtgccactggacgagcgcatcgtcttctcggggaacctcttccagcaccaggag
gacagcaagaagtggagaaaccgcttcagcctcgtgccccacaactacgggctggtgctc
tacgaaaacaaagcggcctatgagcggcaggtcccaccacgagccgtcatcaacagtgca
ggctacaaaatcctcacgtccgtggaccaatacctggagctcattggcaactccttacca
gggaccacggcaaagtcgggcagtgcccccatcctcaagtgccccacacagttcccgctc
atcctctggcatccttatgcgcgtcactactacttctgcatgatgacagaagccgagcag
gacaagtggcaggctgtgctgcaggactgcatccggcactgcaacaatggaatccctgag
gactccaaggtagagggccctgcgttcacagatgccatccgcatgtaccgacagtccaag
gagctgtacggcacctgggagatgctgtgtgggaacgaggtgcagatcctgagcaacctg
gtgatggaggagctgggccctgagctgaaggcagagctcggcccgcggctgaaggggaaa
ccgcaggagcggcagcggcagtggatccagatctcggacgccgtgtaccacatggtgtac
gagcaggccaaggcgcgcttcgaggaggtgctgtccaaggtgcagcaggtgcagccggcc
atgcaggccgtcatccgaactgacatggaccaaattatcacctccaaggagcaccttgcc
agcaagatccgagccttcatcctccccaaggcagaggtgtgcgtgcggaaccatgtccag
ccctacatcccatccatcctggaggccctgatggtccccaccagccagggcttcactgag
gtgcgagatgtcttcttcaaggaggtcacggacatgaacctgaacgtcatcaacgagggc
ggcattgacaagctgggcgagtacatggagaagctgtcccggctggcgtaccaccccctg
aagatgcagagctgctatgagaagatggagtcgctgcgactggacgggctgcagcagcga
tttgatgtgtccagcacgtccgtgttcaagcagcgagcccagatccacatgcgggagcaa
atggacaatgccgtgtatacgttcgagaccctcctgcaccaggagctggggaaggggccc
accaaggaggagctgtgcaagtccatccagcgggtcctggagcgggtgctgaagaaatac
gactacgacagcagctctgtgcggaagaggttcttccgggaggcgctgctgcagatcagc
atcccgttcctgctcaagaagctggcccctacctgcaagtcggagctgccccggttccag
gagctgatcttcgaggactttgccaggttcatcctggtggaaaacacgtacgaggaggtg
gtgctgcagaccgtcatgaaggacatcctgcaggctgtgaaggaggccgcggtgcagagg
aagcacaacctctaccgggacagcatggtcatgcacaacagcgaccccaacctgcacctg
ctggccgagggcgcccccatcgactggggcgaggagtacagcaacagcggcgggggcggc
agccccagccccagcaccccggagtcagccaccctctcggaaaagcgacggcgcgccaag
caggtggtctctgtggtccaggatgaggaggtggggctgccctttgaggctagccctgag
tcaccaccacctgcgtccccggacggtgtcactgagatccgaggcctgctggcccaaggt
ctgcggcctgagagccccccaccagccggccccctgctcaacggggcccccgctggggag
agtccccagcctaaggccgcccccgaggcctcctcgccgcctgcctcacccctccagcat
ctcctgcctggaaaggctgtggaccttgggccccccaagcccagcgaccaggagactgga
gagcaggtgtccagccccagcagccaccccgccctccacaccaccaccgaggacagtgca
ggggtgcagactgagttctag

DBGET integrated database retrieval system