KEGG   Homo sapiens (human): 64857Help
Entry
64857             CDS       T01001                                 

Gene name
PLEKHG2, ARHGEF42, CLG, CTB-60E11.4, LDAMD
Definition
(RefSeq) pleckstrin homology and RhoGEF domain containing G2
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: RhoGEF PH
Motif
Other DBs
NCBI-GeneID: 64857
NCBI-ProteinID: NP_073746
OMIM: 611893
HGNC: 29515
Ensembl: ENSG00000090924
Vega: OTTHUMG00000152570
Pharos: Q9H7P9(Tbio)
UniProt: Q9H7P9
Position
19q13.2
AA seq 1386 aa AA seqDB search
MPEGAQGLSLSKPSPSLGCGRRGEVCDCGTVCETRTAPAAPTMASPRGSGSSTSLSTVGS
EGDPAPGPTPACSASRPEPLPGPPIRLHLSPVGIPGSARPSRLERVAREIVETERAYVRD
LRSIVEDYLGPLLDGGVLGLSVEQVGTLFANIEDIYEFSSELLEDLENSSSAGGIAECFV
QRSEDFDIYTLYCMNYPSSLALLRELSLSPPAALWLQERQAQLRHSLPLQSFLLKPVQRI
LKYHLLLQELGKHWAEGPGTGGREMVEEAIVSMTAVAWYINDMKRKQEHAARLQEVQRRL
GGWTGPELSAFGELVLEGAFRGGGGGGPRLRGGERLLFLFSRMLLVAKRRGLEYTYKGHI
FCCNLSVSESPRDPLGFKVSDLTIPKHRHLLQAKNQEEKRLWIHCLQRLFFENHPASIPA
KAKQVLLENSLHCAPKSKPVLEPLTPPLGSPRPRDARSFTPGRRNTAPSPGPSVIRRGRR
QSEPVKDPYVMFPQNAKPGFKHAGSEGELYPPESQPPVSGSAPPEDLEDAGPPTLDPSGT
SITEEILELLNQRGLRDPGPSTHDIPKFPGDSQVPGDSETLTFQALPSRDSSEEEEEEEE
GLEMDERGPSPLHVLEGLESSIAAEMPSIPCLTKIPDVPNLPEIPSRCEIPEGSRLPSLS
DISDVFEMPCLPAIPSVPNTPSLSSTPTLSCDSWLQGPLQEPAEAPATRRELFSGSNPGK
LGEPPSGGKAGPEEDEEGVSFTDFQPQDVTQHQGFPDELAFRSCSEIRSAWQALEQGQLA
RPGFPEPLLILEDSDLGGDSGSGKAGAPSSERTASRVRELARLYSERIQQMQRAETRASA
NAPRRRPRVLAQPQPSPCLPQEQAEPGLLPAFGHVLVCELAFPLTCAQESVPLGPAVWVQ
AAIPLSKQGGSPDGQGLHVSNLPKQDLPGIHVSAATLLPEQGGSRHVQAPAATPLPKQEG
PLHLQVPALTTFSDQGHPEIQVPATTPLPEHRSHMVIPAPSTAFCPEQGHCADIHVPTTP
ALPKEICSDFTVSVTTPVPKQEGHLDSESPTNIPLTKQGGSRDVQGPDPVCSQPIQPLSW
HGSSLDPQGPGDTLPPLPCHLPDLQIPGTSPLPAHGSHLDHRIPANAPLSLSQELPDTQV
PATTPLPLPQVLTDIWVQALPTSPKQGSLPDIQGPAAAPPLPEPSLTDTQVQKLTPSLEQ
KSLIDAHVPAATPLPERGGSLDIQGLSPTPVQTTMVLSKPGGSLASHVARLESSDLTPPH
SPPPSSRQLLGPNAAALSRYLAASYISQSLARRQGPGGGAPAASRGSWSSAPTSRASSPP
PQPQPPPPPARRLSYATTVNIHVGGGGRLRPAKAQVRLNHPALLASTQESMGLHRAQGAP
DAPFHM
NT seq 4161 nt NT seq  +upstreamnt  +downstreamnt
atgcctgagggagcccaaggactgagcctctccaaacctagcccaagcctcgggtgtggc
cgaagaggtgaagtgtgtgactgtggcaccgtgtgtgagactcggacagctcctgcagcc
cccaccatggcctccccccgaggttctgggagctccacatccctgagcacagtgggctct
gagggggatccagcccctgggcccactccagcctgctcagcctccaggccagagcccctt
ccagggcctcccatccgcctacatctctctccggtggggatcccaggttcagccagaccc
tcaaggctggagcgtgtggcccgggagatcgtggagacagaacgggcctatgtcagggac
ctccgcagcatcgtggaggactacctgggccctctgctggacggcggggtcctggggctg
agcgtggagcaggtgggcacgctgtttgccaacattgaggacatctacgagttcagcagc
gagctcctggaggacttggagaacagcagcagcgccgggggtattgccgagtgcttcgtg
cagaggagcgaggattttgacatctacacattgtactgcatgaactacccgagctccctg
gccctgctccgggagctgtcgttgtctccgccagcagccctgtggctgcaggagcgccag
gcccagcttcgccactcgctgcccctgcagagcttcctgctgaaacctgtccagcgcatt
ctcaagtaccatctgctgctgcaggaactagggaagcactgggcggagggcccaggcact
gggggtcgcgagatggtggaggaagctattgtgtccatgacagcggttgcctggtacatc
aacgacatgaagcgcaagcaggagcatgcagcgcgcctccaggaagtgcagcggcggctg
ggtggctggaccggaccagagctcagtgcttttggggaactggtgttggagggcgcgttc
cgaggaggcggagggggtggcccccggctacgagggggtgagcggctgctcttcctgttc
tctcggatgctgctggtggccaagcgcagggggctggagtacacctacaaaggccacatc
ttctgctgcaacctgagcgtgagcgagagtccccgagaccctctagggttcaaggtgtct
gatctgaccattcccaagcacagacacctgctccaggccaagaaccaagaagagaagagg
ctgtggattcactgtctccagcgcctcttctttgagaaccaccctgcctccatccctgcc
aaggcaaagcaagttctccttgaaaacagcctgcattgtgcccccaaaagtaagcctgtc
ctagagcccctgacacccccacttgggtctcctcgacctcgagatgctagaagttttacc
cctgggcgaaggaacacagctccatctcctgggccctctgtgattcgccgaggccgcagg
cagtctgagccggtgaaggacccttatgtcatgttcccacagaacgctaagcctggattc
aagcacgctggcagcgaaggggaactctaccctccagaatctcagccaccagtttcaggc
tctgcaccccctgaggacctggaggatgctggacccccaacactggacccctctgggacc
tcaatcactgaagaaatcctggaactgctgaatcagcgaggccttcgagatccagggccg
tccacccatgacattcccaagttccccggagactcccaggtgcctggcgacagcgaaacc
ctcacattccaagccctgcccagccgggactcttcagaagaggaggaggaggaagaggaa
gggctggagatggatgaacgggggccttccccactccacgtcctggaagggctcgaaagt
tccattgcagctgaaatgcccagcattccctgccttaccaaaattcctgacgtgcccaac
cttcctgaaattcccagccgctgtgaaattcccgaaggttctcgccttcctagtctctct
gacatttccgatgtttttgagatgccctgccttccagccatacctagtgtccccaacacc
cccagtctgtctagcactcccaccctctcctgtgactcctggctccaagggcctctgcag
gaaccagctgaggctccagccaccaggagagaactgttttctgggagcaatcctgggaaa
ctgggagagccgccttcaggaggcaaggcagggccagaggaggatgaagaaggggtatca
ttcacagacttccagccccaggatgtcacccaacatcagggattcccagatgagctggca
ttccgctcttgctcagaaatccggagcgcctggcaggcattggaacagggacagctggcc
cggccaggcttcccagagccactgctgatcctggaggattcggatctgggtggagacagc
gggagcgggaaggcaggagccccgagttcagaaaggacggcgtcccgagtgcgagagctg
gcccggctttacagcgagcggatccagcagatgcagcgggcggagactcgggcatcagcc
aatgccccgcgccgccggcctcgggttctggcccaaccccagccatccccctgtctgccc
caggagcaggcagagccagggctcctgcctgcctttggacacgtgctggtatgtgagctg
gccttcccactgacatgtgcccaggagtctgtccccctgggtcctgctgtctgggttcaa
gctgccatacctttgtcaaagcagggaggcagcccggatggccagggtctacatgtttcc
aatttgcctaagcaagaccttccgggcatccacgtttcagctgctacccttttgcctgag
caaggaggttcccggcatgtccaggctccagccgccacacctttgcccaagcaagaaggc
cccctgcacctccaggtgccggctcttacaactttctctgatcaaggccacccagaaatc
caagttccagccaccactcctttgcctgagcatagaagtcacatggttataccagctcca
tccaccgccttttgtcctgagcagggacactgtgcggacatccacgttcccaccactcca
gctttgcccaaggagatttgttctgatttcacagtttcagtcaccacccctgtgcccaag
caagaaggtcacctagacagcgagagcccaaccaatatcccactgacaaagcaaggaggt
tccagggatgttcagggcccagaccctgtctgcagtcaacccatccagcctttgtcttgg
catggaagcagcctggatccccagggcccaggcgacaccctaccacccttgccatgtcac
ctcccagaccttcagattccaggtacctcacctttgcctgcacatggaagccacctggac
catcggatcccagccaacgccccactgtctttgtcccaggagctcccagacactcaggtt
ccagctaccacacctttgcccctgccacaagtcctcacagacatctgggtccaagccctc
ccaacttcacccaagcagggaagcctcccagacatccagggtccagcggctgcacctcca
cttccggagccaagccttacagatacacaggtccaaaaactcacaccttcgttggagcag
aagagcctcatagatgcccatgttccagctgccacacctttacctgagagaggaggctct
ctagacattcagggcctctcacccaccccagttcagaccaccatggttttgtccaaacca
ggaggctccttagcctctcacgttgccaggttggagtcttcagacttgacgccacctcat
agtcccccaccttccagccgtcagctcctgggccccaatgcagctgccctctccagatac
ctggcagcctcatatatcagccagagcctggctcggcggcaggggcctgggggaggggcc
cccgcagcctcccggggctcctggtcctctgctcccacgtcacgggcatcttcgccgccc
ccccagccccagccaccacctcccccagccaggcggctcagctatgccacgacggttaac
atccacgtgggcgggggtgggcggctgcggccagccaaggcccaggtccggttgaaccac
cctgctctcttggcctccacacaggaatctatgggccttcacagggcccagggggctcct
gatgcccccttccacatgtga

DBGET integrated database retrieval system