KEGG   Homo sapiens (human): 64859Help
Entry
64859             CDS       T01001                                 

Gene name
NABP1, OBFC2A, SOSS-B2, SSB2
Definition
(RefSeq) nucleic acid binding protein 1
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: tRNA_anti-codon CDC24_OB3 Phage_BR0599
Motif
Other DBs
NCBI-GeneID: 64859
NCBI-ProteinID: NP_001026886
OMIM: 612103
HGNC: 26232
Ensembl: ENSG00000173559
Vega: OTTHUMG00000132720
Pharos: Q96AH0(Tdark)
UniProt: Q96AH0
Position
2q32.3
AA seq 204 aa AA seqDB search
MNRVNDPLIFIRDIKPGLKNLNVVFIVLEIGRVTKTKDGHEVRSCKVADKTGSITISVWD
EIGGLIQPGDIIRLTRGYASMWKGCLTLYTGRGGELQKIGEFCMVYSEVPNFSEPNPDYR
GQQNKGAQSEQKNNSMNSNMGTGTFGPVGNGVHTGPESREHQFSHAGRSNGRGLINPQLQ
GTASNQTVMTTISNGRDPRRAFKR
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atgaatagggtcaacgacccacttatttttataagagatattaagcccggactgaaaaac
ttaaatgtcgtctttattgtcctggagataggacgcgtgaccaaaaccaaagacggccat
gaagtgagatcgtgcaaagtagcagataaaacgggcagcatcactatttccgtgtgggat
gagatcggaggtcttatacagccaggggatattattcggttgaccagagggtatgcatcc
atgtggaaaggatgtctgacactttatactggaaggggtggtgaacttcaaaaaattggg
gaattttgtatggtttattcagaagtgccaaatttcagtgaacccaacccagattatcga
ggacagcagaacaaaggggcacagagtgaacagaagaataattccatgaatagtaatatg
ggtacaggtacatttggaccagtgggaaatggtgttcacactggccctgaatcaagggaa
caccagttttcacatgctggcagaagcaatggccggggacttataaatccacaactacaa
ggaacagctagtaatcaaacagtgatgaccacaataagtaatggcagggaccctcggaga
gcctttaaaagatga

DBGET integrated database retrieval system