KEGG   Homo sapiens (human): 64860
Entry
64860             CDS       T01001                                 

Gene name
ARMCX5, GASP5
Definition
(RefSeq) armadillo repeat containing X-linked 5
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: Arm_2
Other DBs
NCBI-GeneID: 64860
NCBI-ProteinID: NP_001161950
OMIM: 301047
HGNC: 25772
Ensembl: ENSG00000125962
Vega: OTTHUMG00000022062
Pharos: Q6P1M9(Tdark)
UniProt: Q6P1M9
Position
Xq22.1
AA seq 558 aa
MVDSGTEARARGKAEAGLQDGISGPATARVNGKTQAEAVAEAELKTESVTQAKAGDGAMT
RTHTVTYREAMAVTREVIKVEDTTKTRVMVETKTKPLAERSIVPQTKSKAMPMSRVSTVT
KSEVKVVAVIEANIRSYAKSHDKANTGSRPDRREETSIGMKSSDEDEENICSWFWTGEEP
SVGSWFWPEEETSLQVYKPLPKIQEKPKPTHKPTLTIKQKVIAWSRARYIVLVPVEGGEQ
SLPPEGNWTLVETLIETPLGIRPLTKIPPYHGPYYQTLAEIKKQIRQREKYGPNPKACHC
KSRGFSLEPKEFDKLVALLKLTKDPFIHEIATMIMGISPAYPFTQDIIHDVGITVMIENL
VNNPNVKEHPGALSMVDDSSESSEEPKSGESYIHQVCKGIISCPLNSPVQLAGLKLLGHL
SIKFEDHYVITSYIPDFLTLLNKGSVKTKFYVLKVFSCLSKNHANTRELISAKVLSSLVA
PFNKNESKANILNIIEIFENINFQFKTKAKLFTKEKFTKSELISIFQEAKQFGQKLQDLA
EHSDPEVRDKVIRLILKL
NT seq 1677 nt   +upstreamnt  +downstreamnt
atggttgactctgggacagaagcaagggctagaggaaaggctgaggctggcctgcaagat
ggaatcagtggtcctgccactgctagagtgaatggtaaaacccaggccgaggcagtggct
gaggcagaactgaaaacagaatcagtgacccaggccaaagctggtgatggagcaatgacc
aggacacatacagtgacctacagggaggctatggctgtgacaagggaagtgatcaaggtg
gaagatacaactaagactagagtcatggttgagactaagacaaaacccctggcagaacgc
agtatagtgccacaaaccaagtcaaaggccatgcctatgtctagggtcagtactgtaacc
aagtctgaagtcaaggttgttgctgtcattgaggcaaatattaggtcctatgccaagtca
catgataaggccaatactgggtccagacctgacagaagggaagagaccagcattgggatg
aaatccagtgatgaggatgaagaaaatatatgctcctggttctggactggagaagagcct
agtgtagggtcctggttctggcctgaagaagagacctctcttcaagtttataagccccta
cctaagatccaggaaaagcccaagcccacacacaaacccacacttactataaaacaaaag
gtaatagcatggtcaagggccaggtatattgtcctagttccagttgaaggaggggagcaa
tccttgcctccagaaggaaactggaccctggttgagaccttgattgaaactcctctgggg
attcgacctttgaccaagatcccaccttatcatgggccttattaccagaccttagctgag
atcaaaaaacagattaggcaaagggaaaagtatgggcctaatccgaaggcctgccactgc
aaatcacgtggctttagtttagagcctaaagagtttgataaacttgttgccctccttaag
ttaactaaggatcctttcattcatgaaatagctacaatgataatgggcatcagtcctgct
tatccatttactcaagatataattcatgatgtaggtattactgttatgattgaaaacttg
gtcaataatcccaatgttaaagaacaccctggagctttaagtatggtggatgacagctct
gagtcttccgaagaaccaaaatcaggggagtcatatatacatcaagtttgtaaaggcata
atctcttgccccttgaactcccctgtgcagctggctggactgaaattactagggcacttg
agtataaaatttgaagatcactatgtgattaccagttatattccagatttcctcaccttg
ttaaacaagggaagtgtcaaaaccaagttttatgttttaaaagtgttttcgtgtttgtct
aaaaatcacgccaatacaagagaattgatcagtgccaaagtactgtcatcattggttgca
ccctttaacaagaatgagtcaaaggccaatattcttaatattattgaaatatttgagaat
ataaattttcagttcaaaacaaaggcaaagctatttaccaaggaaaagttcactaaatct
gagcttatttcaatattccaggaagcaaaacagtttggtcagaaactccaagacttagca
gagcacagtgatcccgaagtgagagataaagtcatacgattaatactaaaactctga

DBGET integrated database retrieval system