KEGG   Homo sapiens (human): 64866Help
Entry
64866             CDS       T01001                                 

Gene name
CDCP1, CD318, SIMA135, TRASK
Definition
(RefSeq) CUB domain containing protein 1
  KO
K06732  CUB domain-containing protein 1
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:hsa04090]
    64866 (CDCP1)
CD molecules [BR:hsa04090]
 Proteins
  64866 (CDCP1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CUB
Motif
Other DBs
NCBI-GeneID: 64866
NCBI-ProteinID: NP_073753
OMIM: 611735
HGNC: 24357
Ensembl: ENSG00000163814
Vega: OTTHUMG00000133090
Pharos: Q9H5V8(Tbio)
UniProt: Q9H5V8
Position
3p21.31
AA seq 836 aa AA seqDB search
MAGLNCGVSIALLGVLLLGAARLPRGAEAFEIALPRESNITVLIKLGTPTLLAKPCYIVI
SKRHITMLSIKSGERIVFTFSCQSPENHFVIEIQKNIDCMSGPCPFGEVQLQPSTSLLPT
LNRTFIWDVKAHKSIGLELQFSIPRLRQIGPGESCPDGVTHSISGRIDATVVRIGTFCSN
GTVSRIKMQEGVKMALHLPWFHPRNVSGFSIANRSSIKRLCIIESVFEGEGSATLMSANY
PEGFPEDELMTWQFVVPAHLRASVSFLNFNLSNCERKEERVEYYIPGSTTNPEVFKLEDK
QPGNMAGNFNLSLQGCDQDAQSPGILRLQFQVLVQHPQNESNKIYVVDLSNERAMSLTIE
PRPVKQSRKFVPGCFVCLESRTCSSNLTLTSGSKHKISFLCDDLTRLWMNVEKTISCTDH
RYCQRKSYSLQVPSDILHLPVELHDFSWKLLVPKDRLSLVLVPAQKLQQHTHEKPCNTSF
SYLVASAIPSQDLYFGSFCPGGSIKQIQVKQNISVTLRTFAPSFQQEASRQGLTVSFIPY
FKEEGVFTVTPDTKSKVYLRTPNWDRGLPSLTSVSWNISVPRDQVACLTFFKERSGVVCQ
TGRAFMIIQEQRTRAEEIFSLDEDVLPKPSFHHHSFWVNISNCSPTSGKQLDLLFSVTLT
PRTVDLTVILIAAVGGGVLLLSALGLIICCVKKKKKKTNKGPAVGIYNDNINTEMPRQPK
KFQKGRKDNDSHVYAVIEDTMVYGHLLQDSSGSFLQPEVDTYRPFQGTMGVCPPSPPTIC
SRAPTAKLATEEPPPRSPPESESEPYTFSHPNNGDVSSKDTDIPLLNTQEPMEPAE
NT seq 2511 nt NT seq  +upstreamnt  +downstreamnt
atggccggcctgaactgcggggtctctatcgcactgctaggggttctgctgctgggtgcg
gcgcgcctgccgcgcggggcagaagcttttgagattgctctgccacgagaaagcaacatt
acagttctcataaagctggggaccccgactctgctggcaaaaccctgttacatcgtcatt
tctaaaagacatataaccatgttgtccatcaagtctggagaaagaatagtctttaccttt
agctgccagagtcctgagaatcactttgtcatagagatccagaaaaatattgactgtatg
tcaggcccatgtccttttggggaggttcagcttcagccctcgacatcgttgttgcctacc
ctcaacagaactttcatctgggatgtcaaagctcataagagcatcggtttagagctgcag
ttttccatccctcgcctgaggcagatcggtccgggtgagagctgcccagacggagtcact
cactccatcagcggccgaatcgatgccaccgtggtcaggatcggaaccttctgcagcaat
ggcactgtgtcccggatcaagatgcaagaaggagtgaaaatggccttacacctcccatgg
ttccaccccagaaatgtctccggcttcagcattgcaaaccgctcatctataaaacgtctg
tgcatcatcgagtctgtgtttgagggtgaaggctcagcaaccctgatgtctgccaactac
ccagaaggcttccctgaggatgagctcatgacgtggcagtttgtcgttcctgcacacctg
cgggccagcgtctccttcctcaacttcaacctctccaactgtgagaggaaggaggagcgg
gttgaatactacatcccgggctccaccaccaaccccgaggtgttcaagctggaggacaag
cagcctgggaacatggcggggaacttcaacctctctctgcaaggctgtgaccaagatgcc
caaagtccagggatcctccggctgcagttccaagttttggtccaacatccacaaaatgaa
agcaataaaatctacgtggttgacttgagtaatgagcgagccatgtcactcaccatcgag
ccacggcccgtcaaacagagccgcaagtttgtccctggctgtttcgtgtgtctagaatct
cggacctgcagtagcaacctcaccctgacatctggctccaaacacaaaatctccttcctt
tgtgatgatctgacacgtctgtggatgaatgtggaaaaaaccataagctgcacagaccac
cggtactgccaaaggaaatcctactcactccaggtgcccagtgacatcctccacctgcct
gtggagctgcatgacttctcctggaagctgctggtgcccaaggacaggctcagcctggtg
ctggtgccagcccagaagctgcagcagcatacacacgagaagccctgcaacaccagcttc
agctacctcgtggccagtgccatacccagccaggacctgtacttcggctccttctgcccg
ggaggctctatcaagcagatccaggtgaagcagaacatctcggtgacccttcgcaccttt
gcccccagcttccaacaagaggcctccaggcagggtctgacggtgtcctttataccttat
ttcaaagaggaaggcgttttcacggtgacccctgacacaaaaagcaaggtctacctgagg
acccccaactgggaccggggcctgccatccctcacctctgtgtcctggaacatcagcgtg
cccagagaccaggtggcctgcctgactttctttaaggagcggagcggcgtggtctgccag
acagggcgcgcattcatgatcatccaggagcagcggacccgggctgaggagatcttcagc
ctggacgaggatgtgctccccaagccaagcttccaccatcacagcttctgggtcaacatc
tctaactgcagccccacgagcggcaagcagctagacctgctcttctcggtgacacttacc
ccaaggactgtggacttgactgtcatcctcatcgcagcggtgggaggtggagtcttactg
ctgtctgccctcgggctcatcatttgctgtgtgaaaaagaagaaaaagaagacaaacaag
ggccccgctgtgggtatctacaatgacaacatcaatactgagatgccgaggcagccaaaa
aagtttcagaaagggcgaaaggacaatgactcccatgtgtatgcagtcatcgaggacacc
atggtatatgggcatctgctacaggattccagcggctccttcctgcagccagaggtggac
acctaccggccgttccagggcaccatgggggtctgtcctccctccccacccaccatatgc
tccagggccccaactgcaaagttggccactgaggagccacctcctcgctcccctcctgag
tctgagagtgaaccgtacaccttctcccatcccaacaatggggatgtaagcagcaaggac
acagacattcccttactgaacactcaggagcccatggagccagcagaataa

DBGET integrated database retrieval system