KEGG   Homo sapiens (human): 6489Help
Entry
6489              CDS       T01001                                 

Gene name
ST8SIA1, GD3S, SIAT8, SIAT8-A, SIAT8A, ST8SiaI
Definition
(RefSeq) ST8 alpha-N-acetyl-neuraminide alpha-2,8-sialyltransferase 1
  KO
K03371  alpha-N-acetyl-neuraminate alpha-2,8-sialyltransferase (sialyltransferase 8A) [EC:2.4.99.8]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00601  Glycosphingolipid biosynthesis - lacto and neolacto series
hsa00603  Glycosphingolipid biosynthesis - globo and isoglobo series
hsa00604  Glycosphingolipid biosynthesis - ganglio series
hsa01100  Metabolic pathways
Module
hsa_M00069  Glycosphingolipid biosynthesis, ganglio series, LacCer => GT3
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00601 Glycosphingolipid biosynthesis - lacto and neolacto series
    6489 (ST8SIA1)
   00603 Glycosphingolipid biosynthesis - globo and isoglobo series
    6489 (ST8SIA1)
   00604 Glycosphingolipid biosynthesis - ganglio series
    6489 (ST8SIA1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:hsa01003]
    6489 (ST8SIA1)
Enzymes [BR:hsa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.99  Transferring other glycosyl groups
    2.4.99.8  alpha-N-acetylneuraminate alpha-2,8-sialyltransferase
     6489 (ST8SIA1)
Glycosyltransferases [BR:hsa01003]
 Terminal extension
  Sialyltransferase
   6489 (ST8SIA1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_transf_29 Phage_portal_2
Motif
Other DBs
NCBI-GeneID: 6489
NCBI-ProteinID: NP_003025
OMIM: 601123
HGNC: 10869
Ensembl: ENSG00000111728
Vega: OTTHUMG00000169098
Pharos: Q92185(Tbio)
UniProt: Q92185
Position
12p12.1
AA seq 356 aa AA seqDB search
MSPCGRARRQTSRGAMAVLAWKFPRTRLPMGASALCVVVLCWLYIFPVYRLPNEKEIVQG
VLQQGTAWRRNQTAARAFRKQMEDCCDPAHLFAMTKMNSPMGKSMWYDGEFLYSFTIDNS
TYSLFPQATPFQLPLKKCAVVGNGGILKKSGCGRQIDEANFVMRCNLPPLSSEYTKDVGS
KSQLVTANPSIIRQRFQNLLWSRKTFVDNMKIYNHSYIYMPAFSMKTGTEPSLRVYYTLS
DVGANQTVLFANPNFLRSIGKFWKSRGIHAKRLSTGLFLVSAALGLCEEVAIYGFWPFSV
NMHEQPISHHYYDNVLPFSGFHAMPEEFLQLWYLHKIGALRMQLDPCEDTSLQPTS
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atgagcccctgcgggcgggcccggcgacaaacgtccagaggggccatggctgtactggcg
tggaagttcccgcggacccggctgcccatgggagccagtgccctctgtgtcgtggtcctc
tgttggctctacatcttccccgtctaccggctgcccaacgagaaagagatcgtgcagggg
gtgctgcaacagggcacggcgtggaggaggaaccagaccgcggccagagcgttcaggaaa
caaatggaagactgctgcgaccctgcccatctctttgctatgactaaaatgaattcccct
atggggaagagcatgtggtatgacggggagtttttatactcattcaccattgacaattca
acttactctctcttcccacaggcaaccccattccagctgccattgaagaaatgcgcggtg
gtgggaaatggtgggattctgaagaagagtggctgtggccgtcaaatagatgaagcaaat
tttgtcatgcgatgcaatctccctcctttgtcaagtgaatacactaaggatgttggatcc
aaaagtcagttagtgacagctaatcccagcataattcggcaaaggtttcagaaccttctg
tggtccagaaagacatttgtggacaacatgaaaatttataaccacagttacatctacatg
cctgccttttctatgaagacaggaacagagccatctttgagggtttattatacactgtca
gatgttggtgccaatcaaacagtgctgtttgccaaccccaactttctgcgtagcattgga
aagttctggaaaagtagaggaatccatgccaagcgcctgtccacaggactttttctggtg
agcgcagctctgggtctctgtgaagaggtggccatctatggcttctggcccttctctgtg
aatatgcatgagcagcccatcagccaccactactatgacaacgtcttacccttttctggc
ttccatgccatgcccgaggaatttctccaactctggtatcttcataaaatcggtgcactg
agaatgcagctggacccatgtgaagatacctcactccagcccacttcctag

DBGET integrated database retrieval system