KEGG   Homo sapiens (human): 6490Help
Entry
6490              CDS       T01001                                 

Gene name
PMEL, D12S53E, ME20, ME20-M, ME20M, P1, P100, PMEL17, SI, SIL, SILV, gp100
Definition
(RefSeq) premelanosome protein
  KO
K17304  melanocyte protein PMEL
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    6490 (PMEL)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of melanoma cells
   6490 (PMEL)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PKD
Motif
Other DBs
NCBI-GeneID: 6490
NCBI-ProteinID: NP_008859
OMIM: 155550
HGNC: 10880
Ensembl: ENSG00000185664
Vega: OTTHUMG00000170573
Pharos: P40967(Tbio)
UniProt: P40967
Position
12q13.2
AA seq 661 aa AA seqDB search
MDLVLKRCLLHLAVIGALLAVGATKVPRNQDWLGVSRQLRTKAWNRQLYPEWTEAQRLDC
WRGGQVSLKVSNDGPTLIGANASFSIALNFPGSQKVLPDGQVIWVNNTIINGSQVWGGQP
VYPQETDDACIFPDGGPCPSGSWSQKRSFVYVWKTWGQYWQVLGGPVSGLSIGTGRAMLG
THTMEVTVYHRRGSRSYVPLAHSSSAFTITDQVPFSVSVSQLRALDGGNKHFLRNQPLTF
ALQLHDPSGYLAEADLSYTWDFGDSSGTLISRALVVTHTYLEPGPVTAQVVLQAAIPLTS
CGSSPVPGTTDGHRPTAEAPNTTAGQVPTTEVVGTTPGQAPTAEPSGTTSVQVPTTEVIS
TAPVQMPTAESTGMTPEKVPVSEVMGTTLAEMSTPEATGMTPAEVSIVVLSGTTAAQVTT
TEWVETTARELPIPEPEGPDASSIMSTESITGSLGPLLDGTATLRLVKRQVPLDCVLYRY
GSFSVTLDIVQGIESAEILQAVPSGEGDAFELTVSCQGGLPKEACMEISSPGCQPPAQRL
CQPVLPSPACQLVLHQILKGGSGTYCLNVSLADTNSLAVVSTQLIMPGQEAGLGQVPLIV
GILLVLMAVVLASLIYRRRLMKQDFSVPQLPHSSSHWLRLPRIFCSCPIGENSPLLSGQQ
V
NT seq 1986 nt NT seq  +upstreamnt  +downstreamnt
atggatctggtgctaaaaagatgccttcttcatttggctgtgataggtgctttgctggct
gtgggggctacaaaagtacccagaaaccaggactggcttggtgtctcaaggcaactcaga
accaaagcctggaacaggcagctgtatccagagtggacagaagcccagagacttgactgc
tggagaggtggtcaagtgtccctcaaggtcagtaatgatgggcctacactgattggtgca
aatgcctccttctctattgccttgaacttccctggaagccaaaaggtattgccagatggg
caggttatctgggtcaacaataccatcatcaatgggagccaggtgtggggaggacagcca
gtgtatccccaggaaactgacgatgcctgcatcttccctgatggtggaccttgcccatct
ggctcttggtctcagaagagaagctttgtttatgtctggaagacctggggccaatactgg
caagttctagggggcccagtgtctgggctgagcattgggacaggcagggcaatgctgggc
acacacaccatggaagtgactgtctaccatcgccggggatcccggagctatgtgcctctt
gctcattccagctcagccttcaccattactgaccaggtgcctttctccgtgagcgtgtcc
cagttgcgggccttggatggagggaacaagcacttcctgagaaatcagcctctgaccttt
gccctccagctccatgaccccagtggctatctggctgaagctgacctctcctacacctgg
gactttggagacagtagtggaaccctgatctctcgggcacttgtggtcactcatacttac
ctggagcctggcccagtcactgcccaggtggtcctgcaggctgccattcctctcacctcc
tgtggctcctccccagttccaggcaccacagatgggcacaggccaactgcagaggcccct
aacaccacagctggccaagtgcctactacagaagttgtgggtactacacctggtcaggcg
ccaactgcagagccctctggaaccacatctgtgcaggtgccaaccactgaagtcataagc
actgcacctgtgcagatgccaactgcagagagcacaggtatgacacctgagaaggtgcca
gtttcagaggtcatgggtaccacactggcagagatgtcaactccagaggctacaggtatg
acacctgcagaggtatcaattgtggtgctttctggaaccacagctgcacaggtaacaact
acagagtgggtggagaccacagctagagagctacctatccctgagcctgaaggtccagat
gccagctcaatcatgtctacggaaagtattacaggttccctgggccccctgctggatggt
acagccaccttaaggctggtgaagagacaagtccccctggattgtgttctgtatcgatat
ggttccttttccgtcaccctggacattgtccagggtattgaaagtgccgagatcctgcag
gctgtgccgtccggtgagggggatgcatttgagctgactgtgtcctgccaaggcgggctg
cccaaggaagcctgcatggagatctcatcgccagggtgccagccccctgcccagcggctg
tgccagcctgtgctacccagcccagcctgccagctggttctgcaccagatactgaagggt
ggctcggggacatactgcctcaatgtgtctctggctgataccaacagcctggcagtggtc
agcacccagcttatcatgcctggtcaagaagcaggccttgggcaggttccgctgatcgtg
ggcatcttgctggtgttgatggctgtggtccttgcatctctgatatataggcgcagactt
atgaagcaagacttctccgtaccccagttgccacatagcagcagtcactggctgcgtcta
ccccgcatcttctgctcttgtcccattggtgagaacagccccctcctcagtgggcagcag
gtctga

DBGET integrated database retrieval system