KEGG   Homo sapiens (human): 64902
Entry
64902             CDS       T01001                                 

Gene name
AGXT2, AGT2, BAIBA, DAIBAT
Definition
(RefSeq) alanine--glyoxylate aminotransferase 2
  KO
K00827  alanine-glyoxylate transaminase / (R)-3-amino-2-methylpropionate-pyruvate transaminase [EC:2.6.1.44 2.6.1.40]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00250  Alanine, aspartate and glutamate metabolism
hsa00260  Glycine, serine and threonine metabolism
hsa00270  Cysteine and methionine metabolism
hsa00280  Valine, leucine and isoleucine degradation
hsa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    64902 (AGXT2)
   00260 Glycine, serine and threonine metabolism
    64902 (AGXT2)
   00270 Cysteine and methionine metabolism
    64902 (AGXT2)
   00280 Valine, leucine and isoleucine degradation
    64902 (AGXT2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:hsa01007]
    64902 (AGXT2)
Enzymes [BR:hsa01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.40  (R)-3-amino-2-methylpropionate---pyruvate transaminase
     64902 (AGXT2)
    2.6.1.44  alanine---glyoxylate transaminase
     64902 (AGXT2)
Amino acid related enzymes [BR:hsa01007]
 Aminotransferase (transaminase)
  Class III
   64902 (AGXT2)
SSDB
Motif
Pfam: Aminotran_3
Other DBs
NCBI-GeneID: 64902
NCBI-ProteinID: NP_114106
OMIM: 612471
HGNC: 14412
Ensembl: ENSG00000113492
Vega: OTTHUMG00000090788
Pharos: Q9BYV1(Tbio)
UniProt: Q9BYV1
Position
5p13.2
AA seq 514 aa
MTLIWRHLLRPLCLVTSAPRILEMHPFLSLGTSRTSVTKLSLHTKPRMPPCDFMPERYQS
LGYNRVLEIHKEHLSPVVTAYFQKPLLLHQGHMEWLFDAEGSRYLDFFSGIVTVSVGHCH
PKVNAVAQKQLGRLWHTSTVFFHPPMHEYAEKLAALLPEPLKVIFLVNSGSEANELAMLM
ARAHSNNIDIISFRGAYHGCSPYTLGLTNVGTYKMELPGGTGCQPTMCPDVFRGPWGGSH
CRDSPVQTIRKCSCAPDCCQAKDQYIEQFKDTLSTSVAKSIAGFFAEPIQGVNGVVQYPK
GFLKEAFELVRARGGVCIADEVQTGFGRLGSHFWGFQTHDVLPDIVTMAKGIGNGFPMAA
VITTPEIAKSLAKCLQHFNTFGGNPMACAIGSAVLEVIKEENLQENSQEVGTYMLLKFAK
LRDEFEIVGDVRGKGLMIGIEMVQDKISCRPLPREEVNQIHEDCKHMGLLVGRGSIFSQT
FRIAPSMCITKPEVDFAVEVFRSALTQHMERRAK
NT seq 1545 nt   +upstreamnt  +downstreamnt
atgactctaatctggagacatttgctgagacccttgtgcctggtcacttccgctcccagg
atccttgagatgcatcctttcctgagcctaggtacttcccggacatcagtaaccaagctc
agtcttcatacaaagcccagaatgcctccatgtgacttcatgcctgaaagataccagtcc
cttggctacaaccgtgtcctggaaatccacaaggaacatctttctcctgtggtgacggca
tatttccagaaacccctgctgctccaccaggggcacatggagtggctctttgatgctgaa
ggaagcagatacctggatttcttttccgggattgttactgtcagtgttggccattgccac
ccaaaggtgaatgcagtggcacaaaagcagctcggccgcctgtggcatacaagcaccgtc
ttcttccaccctccaatgcatgaatatgcagagaagcttgccgcacttcttcctgagcct
cttaaggtcattttcttggtgaacagtggctcagaagccaatgagctggccatgctgatg
gccagggcgcactcaaacaacatagacatcatttctttcagaggagcctaccatggatgc
agtccttacacacttggcttgacaaacgtagggacctacaagatggaactccctggtggg
acaggttgccaaccaacaatgtgtccagatgtttttcgtggcccttggggaggaagccac
tgtcgagattctccagtgcaaacaatcaggaagtgcagctgtgcaccagactgctgccaa
gctaaagatcagtatattgagcaattcaaagatacgctgagcacatctgtggccaagtca
attgctggatttttcgcagaacctattcaaggtgtgaatggagttgtccagtacccaaag
gggtttctaaaggaagcctttgagctggtgcgagcaaggggaggcgtgtgcattgcagat
gaagtgcagacaggatttggaaggttgggctctcacttctggggcttccaaacccacgat
gtcctgcctgacattgtcaccatggctaaagggattgggaatggctttcccatggcagca
gtcataaccactccagagattgccaaatctttggcgaaatgcctgcagcacttcaacacc
tttggagggaaccccatggcctgtgccattggatctgctgtgcttgaggtgattaaagaa
gaaaatctacaggaaaacagtcaagaagttgggacctacatgttactaaagtttgctaag
ctgcgggatgaatttgaaattgttggagacgtccgaggcaaaggtctcatgataggcata
gaaatggtgcaggataagataagctgtcggcctcttccccgtgaagaagtaaatcagatc
catgaggactgcaagcacatgggactcctcgttggcagaggcagcattttttctcagaca
tttcgcattgcgccctcaatgtgcatcactaaaccagaagttgattttgcagtagaagta
tttcgttctgccttaacccaacacatggaaagaagagctaagtaa

DBGET integrated database retrieval system