KEGG   Homo sapiens (human): 64925
Entry
64925             CDS       T01001                                 
Symbol
CCDC71
Name
(RefSeq) coiled-coil domain containing 71
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: CCDC71L CSRNP_N
Other DBs
NCBI-GeneID: 64925
NCBI-ProteinID: NP_075054
HGNC: 25760
Ensembl: ENSG00000177352
Pharos: Q8IV32(Tdark)
UniProt: Q8IV32
Position
3:complement(49162535..49166331)
AA seq 467 aa
MSVVVQHVEEKAVHSWSRISTAGKKALEEALLVFNPMSQDLSATEAQLVAFLQGLRDDGF
QPTILRSGDVYGYSSCTANPPSQTKLQARAPNPTATSPPASAPRTAMRLPAGRATLLPMP
LSGRLAKASTPALAKHATTNLLLSSLKQSSASHARGAAVGFPTHLYPGVYPAMRLSVVLE
ALVPLKTPMPCLGAKHKAQSLQLSLADSPLKLRKSSGKGPGNPRPKAPRKTTSKGPKCLT
RKGPGAGPRRGSGHQSKTNRATGSPSVRRMKGGSALGTKTAQAKVARTLAKAARAQAKVA
RTQAKAAKARAKAKAAQVKAKAKAKAAQVKAKAKVMAAWAKAKAKAKAVRAKAKVARTQP
RGRGRPKGSAKARTTRKGQKNRPETVGQKRKRAEEAKDLPPKKRTRLGPRSPKAWLGPGT
AKLLKFRAIKVDRRSSDDEVRQRAQRILRVNLSPVIRLQPLLPYSAV
NT seq 1404 nt   +upstreamnt  +downstreamnt
atgagtgtggtggttcagcatgtggaggaaaaagctgtgcactcctggtcgcgcatctcc
acggcagggaagaaggccctggaagaggcactgcttgtctttaacccaatgagccaggat
ctcagtgccacagaggcccagcttgtggccttcctgcagggcctgcgagatgatggcttc
caacctaccatcctgcgcagtggtgatgtctatggctatagttcatgcacagctaatccc
ccaagccagacgaaactgcaagctcgtgcccctaacccaactgccacatcacctccagcc
agtgctccccgaactgccatgcggttgcctgcaggtcgggccacactgcttcccatgccg
ctatctggcagactggccaaagcatccacaccagcccttgccaagcatgctaccaccaac
ctgctgctgagctctctgaagcaatcaagtgccagccatgcccggggtgcagcagtgggc
ttccccacccacctttatccaggtgtctaccctgccatgcggctctctgttgtccttgag
gccctggttccacttaagactcccatgccctgcttgggtgccaagcacaaggcacagtca
ctgcagctctcacttgcagactctcctctgaaactgcggaaaagttcagggaagggtccg
gggaaccctcggcccaaagctcccagaaaaaccacaagcaagggccccaagtgtctgact
cgcaaaggccctggggctggaccccgacgaggctctgggcaccagagcaaaaccaacaga
gccactgggtcccccagtgtccggcgaatgaaagggggctctgccctgggcaccaaaaca
gcccaggccaaggtagctcgaacactggccaaagctgctcgtgcccaagccaaggtggct
cgaacacaggccaaggctgctaaggcccgggccaaggccaaggcagcacaggtcaaggct
aaggccaaagctaaggcagcacaggtcaaggccaaggccaaagtcatggcagcatgggcc
aaggccaaggctaaagccaaggcagtacgggccaaggccaaggtggctcggacccagccc
aggggcagaggcaggccaaagggatctgctaaggccagaactacaaggaagggccagaaa
aaccgccctgagactgttgggcagaagaggaaaagggctgaggaggcaaaagatcttcct
cccaagaagagaacacggcttgggccccgatctcctaaggcatggctagggcctggaaca
gcaaagctgctgaagttccgtgccataaaggtagataggcggtcctcggatgatgaggtg
cggcagcgggctcagcggatcctccgcgtgaacctgtcacctgtaatacggctccagcca
ttgctgccatattcagcagtctga

DBGET integrated database retrieval system