KEGG   Homo sapiens (human): 6494
Entry
6494              CDS       T01001                                 

Symbol
SIPA1, SPA1
Name
(RefSeq) signal-induced proliferation-associated 1
  KO
K08013  signal-induced proliferation-associated gene 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04015  Rap1 signaling pathway
hsa04670  Leukocyte transendothelial migration
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    6494 (SIPA1)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    6494 (SIPA1)
SSDB
Motif
Pfam: Rap_GAP PDZ PDZ_6 MscS_porin ATG16 Rab5-bind CENP-F_N PI3K_P85_iSH2 ZapB HAUS-augmin3 YabA LPP Lzipper-MIP1
Other DBs
NCBI-GeneID: 6494
NCBI-ProteinID: NP_006738
OMIM: 602180
HGNC: 10885
Ensembl: ENSG00000213445
Vega: OTTHUMG00000166541
Pharos: Q96FS4(Tbio)
UniProt: Q96FS4
Position
11q13.1
AA seq 1042 aa
MPMWAGGVGSPRRGMAPASTDDLFARKLRQPARPPLTPHTFEPRPVRGPLLRSGSDAGEA
RPPTPASPRARAHSHEEASRPAATSTRLFTDPLALLGLPAEEPEPAFPPVLEPRWFAHYD
VQSLLFDWAPRSQGMGSHSEASSGTLASAEDQAASSDLLHGAPGFVCELGGEGELGLGGP
ASPPVPPALPNAAVSILEEPQNRTSAYSLEHADLGAGYYRKYFYGKEHQNFFGMDESLGP
VAVSLRREEKEGSGGGTLHSYRVIVRTTQLRTLRGTISEDALPPGPPRGLSPRKLLEHVA
PQLSPSCLRLGSASPKVPRTLLTLDEQVLSFQRKVGILYCRAGQGSEEEMYNNQEAGPAF
MQFLTLLGDVVRLKGFESYRAQLDTKTDSTGTHSLYTTYQDHEIMFHVSTMLPYTPNNQQ
QLLRKRHIGNDIVTIVFQEPGSKPFCPTTIRSHFQHVFLVVRAHTPCTPHTTYRVAVSRT
QDTPAFGPALPAGGGPFAANADFRAFLLAKALNGEQAAGHARQFHAMATRTRQQYLQDLA
TNEVTTTSLDSASRFGLPSLGGRRRAAPRGPGAELQAAGSLVWGVRAAPGARVAAGAQAS
GPEGIEVPCLLGISAEALVLVAPRDGRVVFNCACRDVLAWTFSEQQLDLYHGRGEAITLR
FDGSPGQAVGEVVARLQLVSRGCETRELALPRDGQGRLGFEVDAEGFVTHVERFTFAETA
GLRPGARLLRVCGQTLPSLRPEAAAQLLRSAPKVCVTVLPPDESGRPRRSFSELYTLSLQ
EPSRRGAPDPVQDEVQGVTLLPTTKQLLHLCLQDGGSPPGPGDLAEERTEFLHSQNSLSP
RSSLSDEAPVLPNTTPDLLLATTAKPSVPSADSETPLTQDRPGSPSGSEDKGNPAPELRA
SFLPRTLSLRNSISRIMSEAGSGTLEDEWQAISEIASTCNTILESLSREGQPIPESGDPK
GTPKSDAEPEPGNLSEKVSHLESMLRKLQEDLQKEKADRAALEEEVRSLRHNNRRLQAES
ESAATRLLLASKQLGSPTADLA
NT seq 3129 nt   +upstreamnt  +downstreamnt
atgcccatgtgggccggcggtgtggggagccctcggcggggcatggcccctgcgtccaca
gatgacctctttgcccgcaagctgcgccagccagcaaggcccccgctgacaccgcacacc
ttcgagccgaggccagtccggggcccactcctgcgcagcggcagcgatgcaggcgaggcc
aggccccccacgccagccagcccccgtgcccgtgcccacagccacgaagaggccagccga
cctgcagccacttccacccggctcttcactgacccgctggcactgctggggctgccagca
gaggaaccagagcctgccttcccaccagtgcttgagcctcgatggtttgcccactatgac
gtgcaaagcctgctctttgattgggctccgaggtctcaggggatggggagccactcagag
gccagctctgggaccctggcttcagccgaggaccaggctgccagctcggacctgctgcat
ggggcacctggctttgtgtgtgagctcgggggtgagggtgagctaggcctgggtggacca
gcatccccacctgtgccccctgcactgcccaacgcggccgtgtccatcctggaggagcca
cagaaccgaacctcggcctacagcctggagcacgcagacctgggtgctggctactaccgc
aaatacttctatggcaaagaacatcagaacttcttcgggatggacgagtcgctgggcccg
gtggcagtgagcctgcggcgggaggagaaggagggcagcggagggggcaccctgcacagc
taccgcgtcatcgtgcggaccacgcagctccggacactccgtggcaccatctcggaggac
gcgctgccgccggggcccccacggggtctgtccccaaggaaacttctggagcacgtggcg
ccgcagctgagccccagctgcctgcgcctgggctcagcttcacccaaggtaccacggacg
ctgctcacactggatgagcaagtgctgagcttccaacgcaaggtgggcatcctgtactgc
cgggcgggccagggctcggaggaggagatgtacaacaaccaggaggcgggaccggccttc
atgcagtttctcaccttgctgggcgatgtggtgcggctcaaaggctttgagagttaccgg
gcccagctagacaccaaaacggattccacaggcacgcactccctctacaccacataccag
gaccacgagatcatgttccacgtgtccacgatgctgccttacacccctaataaccagcag
cagctcctccggaagcgccacattggcaacgacattgtgaccatcgtgttccaggagcct
ggcagcaagcccttctgccccaccaccatccgctcgcacttccagcacgtgttcctagtg
gtgcgggcacacacaccctgcacgccacacaccacctacagggtggccgtgagccgcacc
caggacacccctgccttcgggccagctctgcctgctggcggaggccccttcgcagccaac
gccgacttccgggccttcctgctggccaaagcgctgaatggtgagcaggcggccggccac
gcgcgccagttccacgccatggccacgcgcacccgccagcagtacctgcaagacctggcc
accaacgaggtgaccactacgtcgctggactcggcttcacgcttcggcctgccctccctg
ggtgggaggcgccgggcggcccctcggggcccaggcgccgagctgcaggcagcgggctca
ctggtgtggggagtgcgcgcggcgcccggggcgcgggtcgccgccggggctcaggcgagc
ggccccgaaggcatcgaggtgccctgcctgctgggcatctcggccgaggctctggtgctg
gtggcgccgcgcgacggccgcgtagtgttcaattgcgcctgtcgcgacgtgctggcctgg
accttctccgagcagcagctggacctgtaccacggccgcggggaggcgatcacgctgcgc
ttcgacgggtcccccggccaagccgtgggcgaggtggtggcgcgcctgcagctggtgagc
cgtggctgcgagacccgcgagctggcgctgccccgcgacggtcaaggccgcctgggcttc
gaggtggacgccgagggattcgtcacgcacgtggagcgcttcacattcgccgagacggcg
gggctgcggcccggggcgcgcctcctgcgcgtgtgcggccagactctgcccagcctccgg
cccgaggccgctgcccagctcctgcgctcggcgcccaaggtctgcgtcaccgtcctgccc
cccgacgagagcggccggccccgcaggagtttttcggagctgtacacgctgtcgctgcag
gagcctagccggcggggggccccagatcctgtgcaggatgaggtccagggggtgaccctg
ctgcccaccacaaagcagctgctgcacctgtgcctgcaagatggtggcagtcctccaggg
cctggggatctggccgaggagaggactgagttcctgcacagccagaactcgctgtcacca
cgcagctctctgtcggatgaggccccagtcctgcccaacaccaccccggacctcctcctg
gccaccacagccaagccatcagtacccagtgctgacagtgagacacccctgacccaggac
aggccaggcagtcccagtggctctgaggacaagggcaacccggcgccggagctgagggcc
tcctttctgccacgtaccttgtctctgcggaactccatcagcaggatcatgtcggaggcg
ggcagtgggaccctggaggacgagtggcaggccatctcggagattgcctctacttgcaac
accattctggagtcgctgtcccgagagggacagcccatcccagagagtggagaccctaag
ggaactccaaaatctgatgctgagccagagcctgggaacctctcagagaaggtctctcac
ttggagtccatgctcaggaagctgcaggaggacctgcagaaggagaaggcggacagggcg
gccctggaggaggaggtgcggagcctgagacacaacaaccggcggctgcaggcggagtct
gagagtgcagccacacgcctcctcctggcctccaagcagctgggctcacccaccgccgac
ctggcctga

DBGET integrated database retrieval system