KEGG   Homo sapiens (human): 64946
Entry
64946             CDS       T01001                                 

Gene name
CENPH
Definition
(RefSeq) centromere protein H
  KO
K11500  centromere protein H
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    64946 (CENPH)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   Kinetochore proteins
    Centromere proteins
     64946 (CENPH)
SSDB
Motif
Pfam: CENP-H C4bp_oligo
Other DBs
NCBI-GeneID: 64946
NCBI-ProteinID: NP_075060
OMIM: 605607
HGNC: 17268
Ensembl: ENSG00000153044
Vega: OTTHUMG00000097816
Pharos: Q9H3R5(Tbio)
UniProt: Q9H3R5 A0A0S2Z5T0
Position
5q13.2
AA seq 247 aa
MEEQPQMQDADEPADSGGEGRAGGPPQVAGAQAACSEDRMTLLLRLRAQTKQQLLEYKSM
VDASEEKTPEQIMQEKQIEAKIEDLENEIEEVKVAFEIKKLALDRMRLSTALKKNLEKIS
RQSSVLMDNMKHLLELNKLIMKSQQESWDLEEKLLDIRKKRLQLKQASESKLLEIQTEKN
KQKIDLDSMENSERIKIIRQNLQMEIKITTVIQHVFQNLILGSKVNWAEDPALKEIVLQL
EKNVDMM
NT seq 744 nt   +upstreamnt  +downstreamnt
atggaggagcagccccagatgcaagacgccgacgagcccgcggactccggaggggaaggc
cgggcaggcgggccaccgcaggtcgccggcgcccaggcggcgtgcagcgaggaccgcatg
accctgctcctcaggctgagagcacagacaaaacaacaactcttagaatataaatcaatg
gttgatgcaagtgaagaaaaaactccagaacaaattatgcaagaaaagcaaatcgaagct
aaaattgaagacctggaaaatgaaattgaagaggtaaaagttgcttttgagataaaaaag
cttgcattagacaggatgagactttcaactgcacttaaaaaaaacctggagaaaattagc
agacagtctagtgtgctcatggataacatgaaacacctattagagctaaataaattaata
atgaaatcacagcaggaatcttgggatttagaggaaaaactgcttgatattagaaagaag
agattgcaattaaaacaagcttcagaaagtaagcttttagaaatacagactgaaaagaac
aaacagaagattgatttggacagtatggaaaactcagagaggataaagatcatacgacaa
aacctacagatggagataaaaattactactgttattcaacatgtgttccagaaccttatt
ttggggagtaaagtcaattgggcagaggatcctgcccttaaggaaattgttctgcagctt
gagaagaatgttgacatgatgtaa

DBGET integrated database retrieval system