KEGG   Homo sapiens (human): 64965Help
Entry
64965             CDS       T01001                                 

Gene name
MRPS9, MRP-S9, RPMS9, S9mt
Definition
(RefSeq) mitochondrial ribosomal protein S9
  KO
K02996  small subunit ribosomal protein S9
Organism
hsa  Homo sapiens (human)
Pathway
hsa03010  Ribosome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    64965 (MRPS9)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:hsa03011]
    64965 (MRPS9)
Ribosome [BR:hsa03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Small subunit
    64965 (MRPS9)
  Bacteria
    64965 (MRPS9)
  Archaea
    64965 (MRPS9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ribosomal_S9 SAM_3
Motif
Other DBs
NCBI-GeneID: 64965
NCBI-ProteinID: NP_872578
OMIM: 611975
HGNC: 14501
Ensembl: ENSG00000135972
Vega: OTTHUMG00000130807
Pharos: P82933(Tdark)
UniProt: P82933
Position
2q12.1
AA seq 396 aa AA seqDB search
MAAPCVSYGGAVSYRLLLWGRGSLARKQGLWKTAAPELQTNVRSQILRLRHTAFVIPKKN
VPTSKRETYTEDFIKKQIEEFNIGKRHLANMMGEDPETFTQEDIDRAIAYLFPSGLFEKR
ARPVMKHPEQIFPRQRAIQWGEDGRPFHYLFYTGKQSYYSLMHDVYGMLLNLEKHQSHLQ
AKSLLPEKTVTRDVIGSRWLIKEELEEMLVEKLSDLDYMQFIRLLEKLLTSQCGAAEEEF
VQRFRRSVTLESKKQLIEPVQYDEQGMAFSKSEGKRKTAKAEAIVYKHGSGRIKVNGIDY
QLYFPITQDREQLMFPFHFVDRLGKHDVTCTVSGGGRSAQAGAIRLAMAKALCSFVTEDE
VEWMRQAGLLTTDPRVRERKKPGQEGARRKFTWKKR
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atggcggcgccctgtgtgtcctacggcggagcagtttcgtaccggcttcttctctggggt
aggggtagcctcgcccggaagcaaggcctctggaaaaccgcggcccctgagttgcaaaca
aatgtcagatcccagatattaaggctaagacatactgcatttgtaataccaaagaaaaac
gttcctacctcaaaacgtgaaacttacacagaggattttattaaaaagcagattgaagag
ttcaacataggaaagagacatttagccaacatgatgggagaagatccagaaactttcact
caagaagatattgacagagctattgcttaccttttcccaagtggtttgtttgagaaacga
gccaggccagtaatgaagcatcctgaacagatttttccaagacaaagagcaatccagtgg
ggagaagatggccgtccatttcactatctcttctatactggcaaacagtcatactattca
ttaatgcatgatgtatatggaatgttactcaatttagaaaaacatcaaagtcacttgcaa
gccaaaagtctgctcccagaaaaaactgtaaccagagacgtgattggcagcagatggctg
attaaggaggaactagaagaaatgttagtggaaaaactgtcagatctagattatatgcag
ttcattcggctgctagaaaagttattgacatcgcagtgtggtgctgctgaggaagaattt
gtgcagaggtttcgaagaagtgtaactcttgaatcaaaaaaacagctgattgaacctgta
cagtatgatgagcaaggaatggcctttagcaaaagtgaaggtaaaagaaagactgcaaaa
gcagaagcaattgtttataaacatggaagtggaagaataaaagtaaatggaattgattac
cagctttacttcccgatcacacaggacagagaacagctgatgttccctttccactttgtt
gaccggctgggaaagcacgacgtgacctgcacagtctcagggggcgggaggtcagcgcag
gctggagcaatacgactggcaatggcaaaagccttgtgcagctttgtcaccgaggacgag
gtcgagtggatgagacaagctggactacttactactgatccacgtgtgagggaacggaag
aagccaggccaagagggagcccgcagaaagtttacgtggaagaaacgctaa

DBGET integrated database retrieval system