KEGG   Homo sapiens (human): 65008
Entry
65008             CDS       T01001                                 

Gene name
MRPL1, BM022, L1MT, MRP-L1
Definition
(RefSeq) mitochondrial ribosomal protein L1
  KO
K02863  large subunit ribosomal protein L1
Organism
hsa  Homo sapiens (human)
Pathway
hsa03010  Ribosome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    65008 (MRPL1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:hsa03011]
    65008 (MRPL1)
Ribosome [BR:hsa03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    65008 (MRPL1)
  Bacteria
    65008 (MRPL1)
  Archaea
    65008 (MRPL1)
SSDB
Motif
Pfam: Ribosomal_L1 RIIa
Other DBs
NCBI-GeneID: 65008
NCBI-ProteinID: NP_064621
OMIM: 611821
HGNC: 14275
Ensembl: ENSG00000169288
Vega: OTTHUMG00000130200
Pharos: Q9BYD6(Tdark)
UniProt: Q9BYD6
Position
4q21.1
AA seq 325 aa
MAAAVRCMGRALIHHQRHSLSKMVYQTSLCSCSVNIRVPNRHFAAATKSAKKTKKGAKEK
TPDEKKDEIEKIKAYPYMEGEPEDDVYLKRLYPRQIYEVEKAVHLLKKFQILDFTSPKQS
VYLDLTLDMALGKKKNVEPFTSVLSLPYPFASEINKVAVFTENASEVKIAEENGAAFAGG
TSLIQKIWDDEIVADFYVAVPEIMPELNRLRKKLNKKYPKLSRNSIGRDIPKMLELFKNG
HEIKVDEERENFLQTKIATLDMSSDQIAANLQAVINEVCRHRPLNLGPFVVRAFLRSSTS
EGLLLKIDPLLPKEVKNEESEKEDA
NT seq 978 nt   +upstreamnt  +downstreamnt
atggcggcggccgtaaggtgcatgggtagagccttgatacatcatcaaaggcatagcctt
tccaagatggtttatcagacatcactttgttcttgttctgtaaacatccgagtgcccaac
agacattttgctgctgctacaaagtctgcaaagaaaacaaaaaaaggtgctaaagaaaaa
acaccagatgagaaaaaagatgaaatagaaaaaataaaagcatatccctatatggaaggc
gaacctgaggatgatgtctatttaaaacgcttatacccgagacagatatatgaggtggag
aaagctgttcacttacttaagaaatttcaaattcttgactttactagtccaaagcaaagt
gtttatcttgatttgacactggatatggcactgggaaagaagaaaaacgtggagccattt
accagtgttcttagtttgccatacccatttgcttccgaaatcaataaagttgctgtattt
acagagaatgcatcagaggtcaaaatagcggaagaaaatggagctgcatttgcaggaggc
actagtctgatacagaagatttgggatgatgaaattgttgcagacttttacgtagctgtt
ccagaaataatgcctgaacttaatcgattaaggaagaaactgaataaaaaatatccaaag
ctttctcgaaattccattggccgtgacatccccaaaatgcttgaattatttaaaaatgga
catgaaattaaggtagatgaagaaagggagaactttctccagaccaaaatagcaacattg
gatatgtcaagtgaccagatagctgccaatctgcaagcagttattaatgaagtttgtagg
cacagaccgctgaatttgggtccctttgtggtacgtgctttccttcgtagttcaacaagt
gaaggtttattactgaagattgatccattgttgcctaaagaagtaaaaaatgaagaaagt
gaaaaagaagatgcctaa

DBGET integrated database retrieval system