KEGG   Homo sapiens (human): 6502Help
Entry
6502              CDS       T01001                                 

Gene name
SKP2, FBL1, FBXL1, FLB1, p45
Definition
(RefSeq) S-phase kinase associated protein 2
  KO
K03875  F-box and leucine-rich repeat protein 1 (S-phase kinase-associated protein 2)
Organism
hsa  Homo sapiens (human)
Pathway
hsa04068  FoxO signaling pathway
hsa04110  Cell cycle
hsa04120  Ubiquitin mediated proteolysis
hsa04150  mTOR signaling pathway
hsa05168  Herpes simplex infection
hsa05169  Epstein-Barr virus infection
hsa05200  Pathways in cancer
hsa05203  Viral carcinogenesis
hsa05222  Small cell lung cancer
Module
hsa_M00381  SCF-SKP2 complex
Network
N00091  p27-Cell cycle G1/S
N00264  EBV EBNA3C to p27-Cell cycle G1/S
N00484  EBV EBNA3C to p21-cell cycle G1/S
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    6502 (SKP2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    6502 (SKP2)
   04150 mTOR signaling pathway
    6502 (SKP2)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    6502 (SKP2)
 09160 Human Diseases
  09161 Cancers: Overview
   05200 Pathways in cancer
    6502 (SKP2)
   05203 Viral carcinogenesis
    6502 (SKP2)
  09162 Cancers: Specific types
   05222 Small cell lung cancer
    6502 (SKP2)
  09172 Infectious diseases: Viral
   05168 Herpes simplex infection
    6502 (SKP2)
   05169 Epstein-Barr virus infection
    6502 (SKP2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:hsa04121]
    6502 (SKP2)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   SCF complex
    Target recognizing subunit (F-box)
     6502 (SKP2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: F-box-like F-box F-box_5 LRR_8
Motif
Other DBs
NCBI-GeneID: 6502
NCBI-ProteinID: NP_005974
OMIM: 601436
HGNC: 10901
Ensembl: ENSG00000145604
Vega: OTTHUMG00000131106
Pharos: Q13309(Tbio)
UniProt: Q13309 A0A024R069
Structure
PDB: 

Position
5p13.2
AA seq 424 aa AA seqDB search
MHRKHLQEIPDLSSNVATSFTWGWDSSKTSELLSGMGVSALEKEEPDSENIPQELLSNLG
HPESPPRKRLKSKGSDKDFVIVRRPKLNRENFPGVSWDSLPDELLLGIFSCLCLPELLKV
SGVCKRWYRLASDESLWQTLDLTGKNLHPDVTGRLLSQGVIAFRCPRSFMDQPLAEHFSP
FRVQHMDLSNSVIEVSTLHGILSQCSKLQNLSLEGLRLSDPIVNTLAKNSNLVRLNLSGC
SGFSEFALQTLLSSCSRLDELNLSWCFDFTEKHVQVAVAHVSETITQLNLSGYRKNLQKS
DLSTLVRRCPNLVHLDLSDSVMLKNDCFQEFFQLNYLQHLSLSRCYDIIPETLLELGEIP
TLKTLQVFGIVPDGTLQLLKEALPHLQINCSHFTTIARPTIGNKKNQEIWGIKCRLTLQK
PSCL
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
atgcacaggaagcacctccaggagattccagacctgagtagcaacgttgccaccagcttc
acgtggggatgggattccagcaagacttctgaactgctgtcaggcatgggggtctccgcc
ctggagaaagaggagcccgacagtgagaacatcccccaggaactgctctcaaacctgggc
cacccggagagccccccacggaaacggctgaagagcaaagggagtgacaaagactttgtg
attgtccgcaggcctaagctaaatcgagagaactttccaggtgtttcatgggactccctt
ccggatgagctgctcttgggaatcttttcctgtctgtgcctccctgagctgctaaaggtc
tctggtgtttgtaagaggtggtatcgcctagcgtctgatgagtctctatggcagacctta
gacctcacaggtaaaaatctgcacccggatgtgactggtcggttgctgtctcaaggggtg
attgccttccgctgcccacgatcatttatggaccaaccattggctgaacatttcagccct
tttcgtgtacagcacatggacctatcgaactcagttatagaagtgtccaccctccacggc
atactgtctcagtgttccaagttgcagaatctaagcctggaaggcctgcggctttcggat
cccattgtcaatactctcgcaaaaaactcaaatttagtgcgacttaacctttctgggtgt
tctggattctctgaatttgccctgcagactttgctaagcagctgttccagactggatgag
ctgaacctctcctggtgttttgatttcactgaaaagcatgtacaggtggctgttgcgcat
gtgtcagagaccatcacccagctgaatcttagcggctacagaaagaatctccagaaatca
gatctctctactttagttagaagatgccccaatcttgtccatctagacttaagtgatagt
gtcatgctaaagaatgactgctttcaggaatttttccagctcaactacctccaacaccta
tcactcagtcggtgctatgatataatacctgaaactttacttgaacttggagaaattccc
acactaaaaacactacaagtttttggaatcgtgccagatggtacccttcaactgttaaag
gaagcccttcctcatctacagattaattgctcccatttcaccaccattgccaggccaact
attggcaacaaaaagaaccaggagatatggggcatcaaatgccgactgacactgcaaaag
cccagttgtctatga

DBGET integrated database retrieval system