KEGG   Homo sapiens (human): 6504Help
Entry
6504              CDS       T01001                                 

Gene name
SLAMF1, CD150, CDw150, SLAM
Definition
(RefSeq) signaling lymphocytic activation molecule family member 1
  KO
K06536  signaling lymphocytic activation molecule family member 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa05162  Measles
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09172 Infectious diseases: Viral
   05162 Measles
    6504 (SLAMF1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:hsa04090]
    6504 (SLAMF1)
CD molecules [BR:hsa04090]
 Proteins
  6504 (SLAMF1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SLAM Ig_3 ig Receptor_2B4 V-set
Motif
Other DBs
NCBI-GeneID: 6504
NCBI-ProteinID: NP_003028
OMIM: 603492
HGNC: 10903
Ensembl: ENSG00000117090
Vega: OTTHUMG00000024006
Pharos: Q13291(Tbio)
UniProt: Q13291
Position
1q23.3
AA seq 335 aa AA seqDB search
MDPKGLLSLTFVLFLSLAFGASYGTGGRMMNCPKILRQLGSKVLLPLTYERINKSMNKSI
HIVVTMAKSLENSVENKIVSLDPSEAGPPRYLGDRYKFYLENLTLGIRESRKEDEGWYLM
TLEKNVSVQRFCLQLRLYEQVSTPEIKVLNKTQENGTCTLILGCTVEKGDHVAYSWSEKA
GTHPLNPANSSHLLSLTLGPQHADNIYICTVSNPISNNSQTFSPWPGCRTDPSETKPWAV
YAGLLGGVIMILIMVVILQLRRRGKTNHYQTTVEKKSLTIYAQVQKPGPLQKKLDSFPAQ
DPCTTIYVAATEPVPESVQETNSITVYASVTLPES
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
atggatcccaaggggctcctctccttgaccttcgtgctgtttctctccctggcttttggg
gcaagctacggaacaggtgggcgcatgatgaactgcccaaagattctccggcagttggga
agcaaagtgctgctgcccctgacatatgaaaggataaataagagcatgaacaaaagcatc
cacattgtcgtcacaatggcaaaatcactggagaacagtgtcgagaacaaaatagtgtct
cttgatccatccgaagcaggccctccacgttatctaggagatcgctacaagttttatctg
gagaatctcaccctggggatacgggaaagcaggaaggaggatgagggatggtaccttatg
accctggagaaaaatgtttcagttcagcgcttttgcctgcagttgaggctttatgagcag
gtctccactccagaaattaaagttttaaacaagacccaggagaacgggacctgcaccttg
atactgggctgcacagtggagaagggggaccatgtggcttacagctggagtgaaaaggcg
ggcacccacccactgaacccagccaacagctcccacctcctgtccctcaccctcggcccc
cagcatgctgacaatatctacatctgcaccgtgagcaaccctatcagcaacaattcccag
accttcagcccgtggcccggatgcaggacagacccctcagaaacaaaaccatgggcagtg
tatgctgggctgttagggggtgtcatcatgattctcatcatggtggtaatactacagttg
agaagaagaggtaaaacgaaccattaccagacaacagtggaaaaaaaaagccttacgatc
tatgcccaagtccagaaaccaggtcctcttcagaagaaacttgactccttcccagctcag
gacccttgcaccaccatatatgttgctgccacagagcctgtcccagagtctgtccaggaa
acaaattccatcacagtctatgctagtgtgacacttccagagagctga

DBGET integrated database retrieval system