KEGG   Homo sapiens (human): 6505
Entry
6505              CDS       T01001                                 
Symbol
SLC1A1, DCBXA, EAAC1, EAAT3, SCZD18
Name
(RefSeq) solute carrier family 1 member 1
  KO
K05612  solute carrier family 1 (neuronal/epithelial high affinity glutamate transporter), member 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04721  Synaptic vesicle cycle
hsa04724  Glutamatergic synapse
hsa04974  Protein digestion and absorption
Disease
H00911  Dicarboxylic aminoaciduria
H01450  Obsessive-compulsive disorder
H01649  Schizophrenia
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09154 Digestive system
   04974 Protein digestion and absorption
    6505 (SLC1A1)
  09156 Nervous system
   04724 Glutamatergic synapse
    6505 (SLC1A1)
   04721 Synaptic vesicle cycle
    6505 (SLC1A1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    6505 (SLC1A1)
Transporters [BR:hsa02000]
 Solute carrier family (SLC)
  SLC1: High-affinity glutamate and neutral amino acid transporter
   6505 (SLC1A1)
SSDB
Motif
Pfam: SDF
Other DBs
NCBI-GeneID: 6505
NCBI-ProteinID: NP_004161
OMIM: 133550
HGNC: 10939
Ensembl: ENSG00000106688
Pharos: P43005(Tchem)
UniProt: P43005
Structure
Position
9:4490468..4587469
AA seq 524 aa
MGKPARKGCEWKRFLKNNWVLLSTVAAVVLGITTGVLVREHSNLSTLEKFYFAFPGEILM
RMLKLIILPLIISSMITGVAALDSNVSGKIGLRAVVYYFCTTLIAVILGIVLVVSIKPGV
TQKVGEIARTGSTPEVSTVDAMLDLIRNMFPENLVQACFQQYKTKREEVKPPSDPEMNMT
EESFTAVMTTAISKNKTKEYKIVGMYSDGINVLGLIVFCLVFGLVIGKMGEKGQILVDFF
NALSDATMKIVQIIMCYMPLGILFLIAGKIIEVEDWEIFRKLGLYMATVLTGLAIHSIVI
LPLIYFIVVRKNPFRFAMGMAQALLTALMISSSSATLPVTFRCAEENNQVDKRITRFVLP
VGATINMDGTALYEAVAAVFIAQLNDLDLGIGQIITISITATSASIGAAGVPQAGLVTMV
IVLSAVGLPAEDVTLIIAVDWLLDRFRTMVNVLGDAFGTGIVEKLSKKELEQMDVSSEVN
IVNPFALESTILDNEDSDTKKSYVNGGFAVDKSDTISFTQTSQF
NT seq 1575 nt   +upstreamnt  +downstreamnt
atggggaaaccggcgaggaaaggatgcgagtggaagcgcttcctgaagaataactgggtg
ttgctgtccaccgtggccgcggtggtgctaggcattaccacaggagtcttggttcgagaa
cacagcaacctctcaactctagagaaattctactttgcttttcctggagaaattctaatg
cggatgctgaaactcatcattttgccattaattatatccagcatgattacaggtgttgct
gcactggattccaacgtatccggaaaaattggtctgcgcgctgtcgtgtattatttctgt
accactctcattgctgttattctaggtattgtgctggtggtgagcatcaagcctggtgtc
acccagaaagtgggtgaaattgcgaggacaggcagcacccctgaagtcagtacggtggat
gccatgttagatctcatcaggaatatgttccctgagaatcttgtccaggcctgttttcag
cagtacaaaactaagcgtgaagaagtgaagcctcccagcgatccagagatgaacatgaca
gaagagtccttcacagctgtcatgacaactgcaatttccaagaacaaaacaaaggaatac
aaaattgttggcatgtattcagatggcataaacgtcctgggcttgattgtcttttgcctt
gtctttggacttgtcattggaaaaatgggagaaaagggacaaattctggtggatttcttc
aatgctttgagtgatgcaaccatgaaaatcgttcagatcatcatgtgttatatgccacta
ggtattttgttcctgattgctgggaagatcatagaagttgaagactgggaaatattccgc
aagctgggcctttacatggccacagtcctgactgggcttgcaatccactccattgtaatt
ctcccgctgatatatttcatagtcgtacgaaagaaccctttccgatttgccatgggaatg
gcccaggctctcctgacagctctcatgatctcttccagttcagcaacactgcctgtcacc
ttccgctgtgctgaagaaaataaccaggtggacaagaggatcactcgattcgtgttaccc
gttggtgcaacaatcaacatggatgggactgcgctctatgaagcagtggcagcggtgttt
attgcacagttgaatgacctggacttgggcattgggcagatcatcaccatcagtatcacg
gccacatctgccagcatcggagctgctggcgtgccccaggctggcctggtgaccatggtg
attgtgctgagtgccgtgggcctgcccgccgaggatgtcaccctgatcattgctgtcgac
tggctcctggaccggttcaggaccatggtcaacgtccttggtgatgcttttgggacgggc
attgtggaaaagctctccaagaaggagctggagcagatggatgtttcatctgaagtcaac
attgtgaatccctttgccttggaatccacaatccttgacaacgaagactcagacaccaag
aagtcttatgtcaatggaggctttgcagtagacaagtctgacaccatctcattcacccag
acctcacagttctag

DBGET integrated database retrieval system