KEGG   Homo sapiens (human): 6505Help
Entry
6505              CDS       T01001                                 

Gene name
SLC1A1, DCBXA, EAAC1, EAAT3, SCZD18
Definition
(RefSeq) solute carrier family 1 member 1
  KO
K05612  solute carrier family 1 (neuronal/epithelial high affinity glutamate transporter), member 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04724  Glutamatergic synapse
hsa04974  Protein digestion and absorption
Disease
H00911  Dicarboxylic aminoaciduria
H01450  Obsessive-compulsive disorder
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09154 Digestive system
   04974 Protein digestion and absorption
    6505 (SLC1A1)
  09156 Nervous system
   04724 Glutamatergic synapse
    6505 (SLC1A1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    6505 (SLC1A1)
Transporters [BR:hsa02000]
 Solute Carrier Family (SLC)
  SLC1: High-affinity glutamate and neutral amino acid transporter
   6505 (SLC1A1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SDF
Motif
Other DBs
NCBI-GeneID: 6505
NCBI-ProteinID: NP_004161
OMIM: 133550
HGNC: 10939
Ensembl: ENSG00000106688
Vega: OTTHUMG00000019468
Pharos: P43005(Tchem)
UniProt: P43005
Position
9p24.2
AA seq 524 aa AA seqDB search
MGKPARKGCEWKRFLKNNWVLLSTVAAVVLGITTGVLVREHSNLSTLEKFYFAFPGEILM
RMLKLIILPLIISSMITGVAALDSNVSGKIGLRAVVYYFCTTLIAVILGIVLVVSIKPGV
TQKVGEIARTGSTPEVSTVDAMLDLIRNMFPENLVQACFQQYKTKREEVKPPSDPEMNMT
EESFTAVMTTAISKNKTKEYKIVGMYSDGINVLGLIVFCLVFGLVIGKMGEKGQILVDFF
NALSDATMKIVQIIMCYMPLGILFLIAGKIIEVEDWEIFRKLGLYMATVLTGLAIHSIVI
LPLIYFIVVRKNPFRFAMGMAQALLTALMISSSSATLPVTFRCAEENNQVDKRITRFVLP
VGATINMDGTALYEAVAAVFIAQLNDLDLGIGQIITISITATSASIGAAGVPQAGLVTMV
IVLSAVGLPAEDVTLIIAVDWLLDRFRTMVNVLGDAFGTGIVEKLSKKELEQMDVSSEVN
IVNPFALESTILDNEDSDTKKSYVNGGFAVDKSDTISFTQTSQF
NT seq 1575 nt NT seq  +upstreamnt  +downstreamnt
atggggaaaccggcgaggaaaggatgcgagtggaagcgcttcctgaagaataactgggtg
ttgctgtccaccgtggccgcggtggtgctaggcattaccacaggagtcttggttcgagaa
cacagcaacctctcaactctagagaaattctactttgcttttcctggagaaattctaatg
cggatgctgaaactcatcattttgccattaattatatccagcatgattacaggtgttgct
gcactggattccaacgtatccggaaaaattggtctgcgcgctgtcgtgtattatttctgt
accactctcattgctgttattctaggtattgtgctggtggtgagcatcaagcctggtgtc
acccagaaagtgggtgaaattgcgaggacaggcagcacccctgaagtcagtacggtggat
gccatgttagatctcatcaggaatatgttccctgagaatcttgtccaggcctgttttcag
cagtacaaaactaagcgtgaagaagtgaagcctcccagcgatccagagatgaacatgaca
gaagagtccttcacagctgtcatgacaactgcaatttccaagaacaaaacaaaggaatac
aaaattgttggcatgtattcagatggcataaacgtcctgggcttgattgtcttttgcctt
gtctttggacttgtcattggaaaaatgggagaaaagggacaaattctggtggatttcttc
aatgctttgagtgatgcaaccatgaaaatcgttcagatcatcatgtgttatatgccacta
ggtattttgttcctgattgctgggaagatcatagaagttgaagactgggaaatattccgc
aagctgggcctttacatggccacagtcctgactgggcttgcaatccactccattgtaatt
ctcccgctgatatatttcatagtcgtacgaaagaaccctttccgatttgccatgggaatg
gcccaggctctcctgacagctctcatgatctcttccagttcagcaacactgcctgtcacc
ttccgctgtgctgaagaaaataaccaggtggacaagaggatcactcgattcgtgttaccc
gttggtgcaacaatcaacatggatgggactgcgctctatgaagcagtggcagcggtgttt
attgcacagttgaatgacctggacttgggcattgggcagatcatcaccatcagtatcacg
gccacatctgccagcatcggagctgctggcgtgccccaggctggcctggtgaccatggtg
attgtgctgagtgccgtgggcctgcccgccgaggatgtcaccctgatcattgctgtcgac
tggctcctggaccggttcaggaccatggtcaacgtccttggtgatgcttttgggacgggc
attgtggaaaagctctccaagaaggagctggagcagatggatgtttcatctgaagtcaac
attgtgaatccctttgccttggaatccacaatccttgacaacgaagactcagacaccaag
aagtcttatgtcaatggaggctttgcagtagacaagtctgacaccatctcattcacccag
acctcacagttctag

DBGET integrated database retrieval system