KEGG   Homo sapiens (human): 65055Help
Entry
65055             CDS       T01001                                 

Gene name
REEP1, C2orf23, HMN5B, SPG31, Yip2a
Definition
(RefSeq) receptor accessory protein 1
  KO
K17338  receptor expression-enhancing protein 1/2/3/4
Organism
hsa  Homo sapiens (human)
Disease
H00266  Hereditary spastic paraplegia
H00856  Distal hereditary motor neuropathies
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99992 Structural proteins
    65055 (REEP1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TB2_DP1_HVA22 DUF2306 MHCassoc_trimer DUF2304
Motif
Other DBs
NCBI-GeneID: 65055
NCBI-ProteinID: NP_075063
OMIM: 609139
HGNC: 25786
Ensembl: ENSG00000068615
Vega: OTTHUMG00000130205
Pharos: Q9H902(Tbio)
UniProt: Q9H902
Position
2p11.2
AA seq 201 aa AA seqDB search
MVSWIISRLVVLIFGTLYPAYYSYKAVKSKDIKEYVKWMMYWIIFALFTTAETFTDIFLC
WFPFYYELKIAFVAWLLSPYTKGSSLLYRKFVHPTLSSKEKEIDDCLVQAKDRSYDALVH
FGKRGLNVAATAAVMAASKGQGALSERLRSFSMQDLTTIRGDGAPAPSGPPPPGSGRASG
KHGQPKMSRSASESASSSGTA
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atggtgtcatggatcatctccaggctggtggtgcttatatttggcaccctttaccctgcg
tattattcctacaaggctgtgaaatcaaaggacattaaggaatatgtcaaatggatgatg
tactggattatatttgcacttttcaccacagcagagacattcacagacatcttcctttgt
tggtttccattctattatgaactaaaaatagcatttgtagcctggctgctgtctccctac
acaaaaggctccagcctcctgtacaggaagtttgtacatcccacgctatcttcaaaagaa
aaggaaatcgatgattgtctggtccaagcaaaagaccgaagttacgatgcccttgtgcac
ttcgggaagcggggcttgaacgtggccgccacagcggctgtgatggctgcttccaaggga
cagggtgccttatcggagagactgcggagcttcagcatgcaggacctcaccaccatcagg
ggagacggcgcccctgctccctcgggccccccaccaccggggtctgggcgggccagcggc
aaacacggccagcctaagatgtccaggagtgcttctgagagcgctagcagctcaggcacc
gcctag

DBGET integrated database retrieval system