KEGG   Homo sapiens (human): 6506Help
Entry
6506              CDS       T01001                                 

Gene name
SLC1A2, EAAT2, EIEE41, GLT-1, HBGT
Definition
(RefSeq) solute carrier family 1 member 2
  KO
K05613  solute carrier family 1 (glial high affinity glutamate transporter), member 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04721  Synaptic vesicle cycle
hsa04724  Glutamatergic synapse
hsa05014  Amyotrophic lateral sclerosis (ALS)
Disease
H00606  Early infantile epileptic encephalopathy
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09156 Nervous system
   04724 Glutamatergic synapse
    6506 (SLC1A2)
   04721 Synaptic vesicle cycle
    6506 (SLC1A2)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis (ALS)
    6506 (SLC1A2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    6506 (SLC1A2)
Transporters [BR:hsa02000]
 Solute Carrier Family (SLC)
  SLC1: High-affinity glutamate and neutral amino acid transporter
   6506 (SLC1A2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SDF
Motif
Other DBs
NCBI-GeneID: 6506
NCBI-ProteinID: NP_004162
OMIM: 600300
HGNC: 10940
Ensembl: ENSG00000110436
Vega: OTTHUMG00000044391
Pharos: P43004(Tchem)
UniProt: P43004
Position
11p13
AA seq 574 aa AA seqDB search
MASTEGANNMPKQVEVRMHDSHLGSEEPKHRHLGLRLCDKLGKNLLLTLTVFGVILGAVC
GGLLRLASPIHPDVVMLIAFPGDILMRMLKMLILPLIISSLITGLSGLDAKASGRLGTRA
MVYYMSTTIIAAVLGVILVLAIHPGNPKLKKQLGPGKKNDEVSSLDAFLDLIRNLFPENL
VQACFQQIQTVTKKVLVAPPPDEEANATSAVVSLLNETVTEVPEETKMVIKKGLEFKDGM
NVLGLIGFFIAFGIAMGKMGDQAKLMVDFFNILNEIVMKLVIMIMWYSPLGIACLICGKI
IAIKDLEVVARQLGMYMVTVIIGLIIHGGIFLPLIYFVVTRKNPFSFFAGIFQAWITALG
TASSAGTLPVTFRCLEENLGIDKRVTRFVLPVGATINMDGTALYEAVAAIFIAQMNGVVL
DGGQIVTVSLTATLASVGAASIPSAGLVTMLLILTAVGLPTEDISLLVAVDWLLDRMRTS
VNVVGDSFGAGIVYHLSKSELDTIDSQHRVHEDIEMTKTQSIYDDMKNHRESNSNQCVYA
AHNSVIVDECKVTLAANGKSADCSVEEEPWKREK
NT seq 1725 nt NT seq  +upstreamnt  +downstreamnt
atggcatctacggaaggtgccaacaatatgcccaagcaggtggaagtgcgaatgcacgac
agtcatcttggctcagaggaacccaagcaccggcacctgggcctgcgcctgtgtgacaag
ctggggaagaatctgctgctcaccctgacggtgtttggtgtcatcctgggagcagtgtgt
ggagggcttcttcgcttggcatctcccatccaccctgatgtggttatgttaatagccttc
ccaggggatatactcatgaggatgctaaaaatgctcattctccctctaatcatctccagc
ttaatcacagggttgtcaggcctggatgctaaggctagtggccgcttgggcacgagagcc
atggtgtattacatgtccacgaccatcattgctgcagtactgggggtcattctggtcttg
gctatccatccaggcaatcccaagctcaagaagcagctggggcctgggaagaagaatgat
gaagtgtccagcctggatgccttcctggaccttattcgaaatctcttccctgaaaacctt
gtccaagcctgctttcaacagattcaaacagtgacgaagaaagtcctggttgcaccaccg
ccggacgaggaggccaacgcaaccagcgctgttgtctctctgttgaacgagactgtgact
gaggtgccggaggagactaagatggttatcaagaagggcctggagttcaaggatgggatg
aacgtcttaggtctgatagggtttttcattgcttttggcatcgctatggggaagatggga
gatcaggccaagctgatggtggatttcttcaacattttgaatgagattgtaatgaagtta
gtgatcatgatcatgtggtactctcccctgggtatcgcctgcctgatctgtggaaagatc
attgcaatcaaggacttagaagtggttgctaggcaactggggatgtacatggtaacagtg
atcataggcctcatcatccacgggggcatctttctccccttgatttactttgtagtgacc
aggaaaaaccccttctccttttttgctggcattttccaagcttggatcactgccctgggc
accgcttccagtgctggaactttgcctgtcacctttcgttgcctggaagaaaatctgggg
attgataagcgtgtgactagattcgtccttcctgttggagcaaccattaacatggatggt
acagccctttatgaagcggtagccgccatctttatagcccaaatgaatggtgttgtcctg
gatggaggacagattgtgactgtaagcctcacagccaccctggcaagcgtcggcgcggcc
agtatccccagtgccgggctggtcaccatgctcctcattctgacagccgtgggcctgcca
acagaggacatcagcctgctggtggctgtggactggctgctggacaggatgagaacttca
gtcaatgttgtgggtgactcttttggggctgggatagtctatcacctctccaagtctgag
ctggataccattgactcccagcatcgagtgcatgaagatattgaaatgaccaagactcaa
tccatttatgatgacatgaagaaccacagggaaagcaactctaatcaatgtgtctatgct
gcacacaactctgtcatagtagatgaatgcaaggtaactctggcagccaatggaaagtca
gccgactgcagtgttgaggaagaaccttggaaacgtgagaaataa

KEGG   Homo sapiens (human): 6512Help
Entry
6512              CDS       T01001                                 

Gene name
SLC1A7, AAAT, EAAT5
Definition
(RefSeq) solute carrier family 1 member 7
  KO
K05618  solute carrier family 1 (glutamate transporter), member 7
Organism
hsa  Homo sapiens (human)
Pathway
hsa04721  Synaptic vesicle cycle
hsa04724  Glutamatergic synapse
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09156 Nervous system
   04724 Glutamatergic synapse
    6512 (SLC1A7)
   04721 Synaptic vesicle cycle
    6512 (SLC1A7)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    6512 (SLC1A7)
Transporters [BR:hsa02000]
 Solute Carrier Family (SLC)
  SLC1: High-affinity glutamate and neutral amino acid transporter
   6512 (SLC1A7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SDF DUF2417
Motif
Other DBs
NCBI-GeneID: 6512
NCBI-ProteinID: NP_006662
OMIM: 604471
HGNC: 10945
Ensembl: ENSG00000162383
Vega: OTTHUMG00000008937
Pharos: O00341(Tchem)
UniProt: O00341 F1T0D3
Position
1p32.3
AA seq 560 aa AA seqDB search
MVPHAILARGRDVCRRNGLLILSVLSVIVGCLLGFFLRTRRLSPQEISYFQFPGELLMRM
LKMMILPLVVSSLMSGLASLDAKTSSRLGVLTVAYYLWTTFMAVIVGIFMVSIIHPGSAA
QKETTEQSGKPIMSSADALLDLIRNMFPANLVEATFKQYRTKTTPVVKSPKVAPEEAPPR
RILIYGVQEENGSHVQNFALDLTPPPEVVYKSEPGTSDGMNVLGIVFFSATMGIMLGRMG
DSGAPLVSFCQCLNESVMKIVAVAVWYFPFGIVFLIAGKILEMDDPRAVGKKLGFYSVTV
VCGLVLHGLFILPLLYFFITKKNPIVFIRGILQALLIALATSSSSATLPITFKCLLENNH
IDRRIARFVLPVGATINMDGTALYEAVAAIFIAQVNNYELDFGQIITISITATAASIGAA
GIPQAGLVTMVIVLTSVGLPTDDITLIIAVDWALDRFRTMINVLGDALAAGIMAHICRKD
FARDTGTEKLLPCETKPVSLQEIVAAQQNGCVKSVAEASELTLGPTCPHHVPVQVEQDEE
LPAASLNHCTIQISELETNV
NT seq 1683 nt NT seq  +upstreamnt  +downstreamnt
atggtgccgcatgccatcttggcacgggggagggacgtgtgcaggcggaatggactcctc
atcctgtctgtgctgtctgtcatcgtgggctgcctcctcggcttcttcttgaggacccgg
cgcctctcaccacaggaaattagttacttccagttccctggagagctcctgatgaggatg
ctgaagatgatgatcctgccactggtggtctccagcttgatgtccggacttgcctccctg
gatgccaagacctctagccgcctgggcgtcctcaccgtggcgtactacctgtggaccacc
ttcatggctgtcatcgtgggcatcttcatggtctccatcatccacccaggcagcgcggcc
cagaaggagaccacggagcagagtgggaagcccatcatgagctcagccgatgccctgttg
gacctcatccggaacatgttcccagccaacctagtagaagccacattcaaacagtaccgc
accaagaccaccccagttgtcaagtcccccaaggtggcaccagaggaggcccctcctcgg
cggatcctcatctacggggtccaggaggagaatggctcccatgtgcagaacttcgccctg
gacctgaccccgccgcccgaggtcgtttacaagtcagagccgggcaccagcgatggcatg
aatgtgctgggcatcgtcttcttctctgccaccatgggcatcatgctgggccgcatgggt
gacagcggggcccccctggtcagcttctgccagtgcctcaatgagtcggtcatgaagatc
gtggcggtggctgtgtggtatttccccttcggcattgtgttcctcattgcgggtaagatc
ctggagatggacgaccccagggccgtcggcaagaagctgggcttctactcagtcaccgtg
gtgtgcgggctggtgctccacgggctctttatcctgcccctgctctacttcttcatcacc
aagaagaatcccatcgtcttcatccgtggcatcctgcaggctctgctcatcgcgctggcc
acctcctccagctcagccacactgcccatcaccttcaagtgcctgctggagaacaaccac
atcgaccggcgcatcgctcgcttcgtgctgcccgtgggtgccaccatcaacatggacggc
actgcgctctacgaggctgtggccgccatcttcatcgcccaggtcaacaactacgagctg
gactttggccagatcatcaccatcagtatcacagccactgcagccagcattggggcagct
ggcatcccccaggccggcctcgtcaccatggtcatcgtgctcacctccgtgggactgccc
accgatgacatcaccctcatcattgccgttgactgggctctggaccgtttccgcaccatg
attaacgtgctgggtgatgcgctggcagcggggatcatggcccatatatgtcggaaggat
tttgcccgggacacaggcaccgagaaactgctgccctgcgagaccaagccagtgagcctc
caggagatcgtggcagcccagcagaatggctgtgtgaagagtgtagccgaggcctccgag
ctcaccctgggccccacctgcccccaccacgtccccgttcaagtggagcaggatgaggag
ctgcccgctgcgagtctgaaccactgcaccatccagatcagtgagctggagaccaatgtc
tga

DBGET integrated database retrieval system