KEGG   Homo sapiens (human): 65061Help
Entry
65061             CDS       T01001                                 

Gene name
CDK15, ALS2CR7, PFTAIRE2, PFTK2
Definition
(RefSeq) cyclin dependent kinase 15
  KO
K15594  cyclin-dependent kinase 15 [EC:2.7.11.22]
Organism
hsa  Homo sapiens (human)
Brite
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     65061 (CDK15)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: CMGC group
  CDK family
   65061 (CDK15)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Haspin_kinase Kinase-like Seadorna_VP7
Motif
Other DBs
NCBI-GeneID: 65061
NCBI-ProteinID: NP_001248364
OMIM: 616147
HGNC: 14434
Ensembl: ENSG00000138395
Vega: OTTHUMG00000132838
Pharos: Q96Q40(Tdark)
UniProt: Q96Q40
Position
2q33.1
AA seq 429 aa AA seqDB search
MGQELCAKTVQPGCSCYHCSEGGEAHSCRRSQPETTEAAFKLTDLKEASCSMTSFHPRGL
QAARAQKFKSKRPRSNSDCFQEEDLRQGFQWRKSLPFGAASSYLNLEKLGEGSYATVYKG
ISRINGQLVALKVISMNAEEGVPFTAIREASLLKGLKHANIVLLHDIIHTKETLTFVFEY
MHTDLAQYMSQHPGGLHPHNVRLFMFQLLRGLAYIHHQHVLHRDLKPQNLLISHLGELKL
ADFGLARAKSIPSQTYSSEVVTLWYRPPDALLGATEYSSELDIWGAGCIFIEMFQGQPLF
PGVSNILEQLEKIWEVLGVPTEDTWPGVSKLPNYNPEWFPLPTPRSLHVVWNRLGRVPEA
EDLASQMLKGFPRDRVSAQEALVHDYFSALPSQLYQLPDVSGVRLKPEMCDLLASYQKGH
HPAQFSKCW
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atgggtcaagagctgtgtgcaaagactgtacagcctggatgcagctgctaccattgttca
gagggaggcgaggcacacagctgtcggaggagtcagcctgagaccacggaggctgcgttc
aagctaacagacctaaaagaagcatcatgttccatgacttcatttcaccccaggggactt
caagctgcccgtgcccagaagttcaagagtaaaaggccacggagtaacagtgattgtttt
caggaagaggatctgaggcagggttttcagtggaggaagagcctcccttttggggcagcc
tcatcttacttgaacttggagaagctgggtgaaggctcttatgcgacagtttacaagggg
attagcagaataaatggacaactagtggctttaaaagtcatcagcatgaatgcagaggaa
ggagtcccatttacagctatccgagaagcttctctcctgaagggtttgaaacatgccaat
attgtgctcctgcatgacataatccacaccaaagagacactgacattcgtttttgaatac
atgcacacagacctggcccagtatatgtctcagcatccaggagggcttcatcctcataat
gtcagacttttcatgtttcaacttttgcggggcctggcgtacatccaccaccaacacgtt
cttcacagggacctgaaacctcagaacttactcatcagtcacctgggagagctcaaactg
gctgattttggtcttgcccgggccaagtccattcccagccagacatactcttcagaagtc
gtgaccctctggtaccggccccctgatgctttgctgggagccactgaatattcctctgag
ctggacatatggggtgcaggctgcatctttattgaaatgttccagggtcaacctttgttt
cctggggtttccaacatccttgaacagctggagaaaatctgggaggtgctgggagtccct
acagaggatacttggccgggagtctccaagctacctaactacaatccagaatggttccca
ctgcctacgcctcgaagccttcatgttgtctggaacaggctgggcagggttcctgaagct
gaagacctggcctcccagatgctaaaaggctttcccagagaccgcgtctccgcccaggaa
gcacttgttcatgattatttcagcgccctgccatctcagctgtaccagcttcctgatgtt
tcaggagtgaggctaaagccagaaatgtgtgaccttttggcctcctaccagaaaggtcac
cacccagcccagtttagcaaatgctggtga

DBGET integrated database retrieval system