KEGG   Homo sapiens (human): 6508Help
Entry
6508              CDS       T01001                                 

Gene name
SLC4A3, AE3, CAE3/BAE3, SLC2C
Definition
(RefSeq) solute carrier family 4 member 3
  KO
K13856  solute carrier family 4 (anion exchanger), member 3
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    6508 (SLC4A3)
Transporters [BR:hsa02000]
 Solute carrier family (SLC)
  SLC4: Bicarbonate transporter
   6508 (SLC4A3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HCO3_cotransp Band_3_cyto PTS_EIIA_2
Motif
Other DBs
NCBI-GeneID: 6508
NCBI-ProteinID: NP_005061
OMIM: 106195
HGNC: 11029
Ensembl: ENSG00000114923
Vega: OTTHUMG00000059238
Pharos: P48751(Tdark)
UniProt: P48751
Position
2q35
AA seq 1232 aa AA seqDB search
MANGVIPPPGGASPLPQVRVPLEEPPLSPDVEEEDDDLGKTLAVSRFGDLISKPPAWDPE
KPSRSYSERDFEFHRHTSHHTHHPLSARLPPPHKLRRLPPTSARHTRRKRKKEKTSAPPS
EGTPPIQEEGGAGVDEEEEEEEEEEGESEAEPVEPPHSGTPQKAKFSIGSDEDDSPGLPG
RAAVTKPLPSVGPHTDKSPQHSSSSPSPRARASRLAGEKSRPWSPSASYDLRERLCPGSA
LGNPGGPEQQVPTDEAEAQMLGSADLDDMKSHRLEDNPGVRRHLVKKPSRTQGGRGSPSG
LAPILRRKKKKKKLDRRPHEVFVELNELMLDRSQEPHWRETARWIKFEEDVEEETERWGK
PHVASLSFRSLLELRRTIAHGAALLDLEQTTLPGIAHLVVETMIVSDQIRPEDRASVLRT
LLLKHSHPNDDKDSGFFPRNPSSSSMNSVLGNHHPTPSHGPDGAVPTMADDLGEPAPLWP
HDPDAKEKPLHMPGGDGHRGKSLKLLEKIPEDAEATVVLVGCVPFLEQPAAAFVRLNEAV
LLESVLEVPVPVRFLFVMLGPSHTSTDYHELGRSIATLMSDKLFHEAAYQADDRQDLLSA
ISEFLDGSIVIPPSEVEGRDLLRSVAAFQRELLRKRREREQTKVEMTTRGGYTAPGKELS
LELGGSEATPEDDPLLRTGSVFGGLVRDVRRRYPHYPSDLRDALHSQCVAAVLFIYFAAL
SPAITFGGLLGEKTEGLMGVSELIVSTAVLGVLFSLLGAQPLLVVGFSGPLLVFEEAFFK
FCRAQDLEYLTGRVWVGLWLVVFVLALVAAEGSFLVRYISPFTQEIFAFLISLIFIYETF
YKLYKVFTEHPLLPFYPPEGALEGSLDAGLEPNGSALPPTEGPPSPRNQPNTALLSLILM
LGTFFIAFFLRKFRNSRFLGGKARRIIGDFGIPISILVMVLVDYSITDTYTQKLTVPTGL
SVTSPDKRSWFIPPLGSARPFPPWMMVAAAVPALLVLILIFMETQITALIVSQKARRLLK
GSGFHLDLLLIGSLGGLCGLFGLPWLTAATVRSVTHVNALTVMRTAIAPGDKPQIQEVRE
QRVTGVLIASLVGLSIVMGAVLRRIPLAVLFGIFLYMGVTSLSGIQLSQRLLLILMPAKH
HPEQPYVTKVKTWRMHLFTCIQLGCIALLWVVKSTAASLAFPFLLLLTVPLRHCLLPRLF
QDRELQALDSEDAEPNFDEDGQDEYNELHMPV
NT seq 3699 nt NT seq  +upstreamnt  +downstreamnt
atggccaacggagtgatcccgccgcccgggggcgcctcccccctaccccaggtccgggtg
cccttggaggagccccctctaagtccagacgtggaggaggaggacgatgacttgggcaag
accttggctgtgagcaggtttggggacctcatcagcaagcccccggcctgggaccccgag
aagcccagccgcagctacagcgagcgggactttgagtttcaccggcacacatcccaccac
acccaccacccgctctcagcgcgcctgcctccaccccacaagctgcggcggctgcccccc
acctctgcccggcacaccaggagaaagaggaagaaggagaaaacctctgctcctccctcc
gaggggacccctcccatccaggaggaggggggagctggagtggatgaggaagaggaggaa
gaggaggaagaggaaggagaatctgaggcagaacctgtggagcccccccactcagggacc
ccacagaaggcaaagttctccattggaagtgacgaggatgacagtccaggcctccctggg
agggctgctgtcaccaagcccctgccctcggtgggcccacacactgacaagagcccccag
cactccagcagctcccccagcccccgggcccgggcctcccgactcgctggggagaaaagc
cggccctggagcccatcggccagttatgacctgcgggagcgactgtgcccaggcagtgcc
ctgggcaacccaggtggtccagagcagcaggtgcccacagatgaggcggaggcccagatg
ctgggttctgcagacctggacgacatgaagagtcaccgactggaggacaaccctggtgtg
cggcgacacttagtgaaaaagccctcccggacgcagggcgggaggggcagtcccagcggc
ctggcccccatccttcgcaggaagaagaagaagaaaaagctggaccggaggcctcatgag
gtgttcgtggagctgaacgagctgatgctggaccgcagccaggagccccactggcgggag
acggcccgctggatcaagtttgaggaggacgtggaggaggagacggagcgctgggggaag
ccccatgttgcctcgctctccttccgtagccttctggagctcaggaggaccatcgcccat
ggagctgccctcctggacctggagcaaaccaccctgccaggcattgcacacctcgtggtg
gagaccatgattgtgtctgaccagatccggccggaggacagggccagcgtcctacgtacc
ctgctactgaagcacagccatcccaacgatgacaaggacagtggcttctttccccgaaac
ccatcgagctccagcatgaactcggttctggggaatcatcacccaactcccagccatggc
cctgatggggcggtgcctaccatggctgatgacctgggggagccagccccactctggcca
catgaccctgacgccaaggagaagcccctccacatgcctgggggagatggtcaccggggg
aaaagcctgaagctgctggagaagatccctgaagatgctgaggccacggttgtgcttgtg
ggttgtgtgcctttcttggagcagcctgcagcagccttcgtgcgtctgaatgaggctgta
ctcctggagtctgtgcttgaggtccctgtcccggtccgcttcctcttcgtgatgctgggg
cccagccacaccagcactgactatcacgagcttgggcgctccattgccacccttatgtct
gacaagctgtttcatgaggctgcctaccaggcagatgaccggcaagacctcctaagtgcc
atcagcgagttcctggatggcagcattgtgatccccccgtccgaggtggagggccgtgac
ctgctgcgctccgtggctgctttccagcgagagctgcttaggaagcggcgagagcgtgaa
cagaccaaagtcgagatgaccacacggggtggctacacggcccctgggaaagaactgtct
ttggagttggggggctctgaggcaacccctgaagatgaccccttgctgcggacgggctcg
gtatttggggggcttgtgcgggatgtgaggcgccggtacccgcactaccccagtgacctg
cgagatgcgctgcactcccagtgtgtggccgctgtgctcttcatctacttcgcagccctc
agccctgccatcaccttcggggggctgctgggagagaagaccgaggggctgatgggcgtg
tccgagctgatcgtgtccaccgctgtgctcggcgtcctcttctctctgctgggagctcag
ccgctgcttgtggttggcttctctgggccgctgcttgtgtttgaggaagccttcttcaag
ttctgccgagcccaggacctggagtacctcactggccgggtgtgggttggtctctggctg
gtggtcttcgtccttgccctggtggccgccgaaggcagcttcctggtccgctacatctcg
cctttcacccaggagatctttgcctttctcatctcactcattttcatctacgagaccttc
tacaagctctacaaggtgttcacagagcacccactgctgccgttctacccccctgagggg
gccctggaggggtccctggatgctggtctggagccaaatggcagtgccctgccccccacc
gagggcccccccagcccgaggaaccagcccaatacggcactgctctcactcatcctcatg
ctcgggaccttcttcatagccttcttcctgcgcaagttcaggaacagccgcttcctgggg
ggcaaggctcgtcgcatcatcggggactttggcatccccatctccatcctggtgatggtc
ctggtggattactccatcacagacacctacacgcagaagctgacagtgcctacagggctc
tcagtgacctctcccgataagcgctcgtggttcatcccacccctgggcagtgcccgtcct
ttcccgccgtggatgatggtggcagccgctgttcccgccctcctcgtcctcatcctgatc
ttcatggagacacagatcacggcgcttatcgtcagccagaaggcgcggaggctgctcaag
ggctccggtttccacctggacctgctcctcattggctccctgggggggctctgtgggctg
tttgggttgccctggctcacggctgccacggtccgctccgtcacccatgtcaatgcgttg
acagtgatgcgtactgccatcgcgcctggtgacaagccccagatccaggaggtgcgggag
cagcgggtcactggtgtgctcatcgccagcctcgtgggcctgtccatcgtcatgggggct
gtgctgcgtcggatcccattggctgtgctctttgggatcttcctgtacatgggggtcacg
tccctgtctggtatccagctgtcccagcgtttgttgctcatcctcatgccggcaaaacac
catcctgagcagccctatgtgaccaaggtgaagacgtggcggatgcatctgttcacctgc
atccagctgggctgcatcgcactgctctgggtggtcaagtccacggcggcctcactcgcc
tttcccttcctgctgctgctcacggtgcctctgaggcattgccttctgccccggctcttc
caggacagggagctgcaggcgctggactcggaagatgctgaaccaaacttcgatgaggat
ggccaggatgagtacaatgagctgcacatgccagtgtga

DBGET integrated database retrieval system