KEGG   Homo sapiens (human): 6511Help
Entry
6511              CDS       T01001                                 

Gene name
SLC1A6, EAAT4
Definition
(RefSeq) solute carrier family 1 member 6
  KO
K05617  solute carrier family 1 (high affinity glutamate/aspartate transporter), member 6
Organism
hsa  Homo sapiens (human)
Pathway
hsa04721  Synaptic vesicle cycle
hsa04724  Glutamatergic synapse
hsa05017  Spinocerebellar ataxia
Network
nt06440  Transcription
nt06462  Spinocerebellar ataxia
  Element
N00965  RORA-mediated transcription
N00966  Mutation-caused aberrant ATXN1 to RORA-mediated transcription
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09156 Nervous system
   04724 Glutamatergic synapse
    6511 (SLC1A6)
   04721 Synaptic vesicle cycle
    6511 (SLC1A6)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05017 Spinocerebellar ataxia
    6511 (SLC1A6)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    6511 (SLC1A6)
Transporters [BR:hsa02000]
 Solute carrier family (SLC)
  SLC1: High-affinity glutamate and neutral amino acid transporter
   6511 (SLC1A6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SDF
Motif
Other DBs
NCBI-GeneID: 6511
NCBI-ProteinID: NP_005062
OMIM: 600637
HGNC: 10944
Ensembl: ENSG00000105143
Vega: OTTHUMG00000183351
Pharos: P48664(Tchem)
UniProt: P48664 B7Z7Q5
Position
19p13.12
AA seq 564 aa AA seqDB search
MSSHGNSLFLRESGQRLGRVGWLQRLQESLQQRALRTRLRLQTMTLEHVLRFLRRNAFIL
LTVSAVVIGVSLAFALRPYQLTYRQIKYFSFPGELLMRMLQMLVLPLIVSSLVTGMASLD
NKATGRMGMRAAVYYMVTTIIAVFIGILMVTIIHPGKGSKEGLHREGRIETIPTADAFMD
LIRNMFPPNLVEACFKQFKTQYSTRVVTRTMVRTENGSEPGASMPPPFSVENGTSFLENV
TRALGTLQEMLSFEETVPVPGSANGINALGLVVFSVAFGLVIGGMKHKGRVLRDFFDSLN
EAIMRLVGIIIWYAPVGILFLIAGKILEMEDMAVLGGQLGMYTLTVIVGLFLHAGIVLPL
IYFLVTHRNPFPFIGGMLQALITAMGTSSSSATLPITFRCLEEGLGVDRRITRFVLPVGA
TVNMDGTALYEALAAIFIAQVNNYELNLGQITTISITATAASVGAAGIPQAGLVTMVIVL
TSVGLPTEDITLIIAVDWFLDRLRTMTNVLGDSIGAAVIEHLSQRELELQEAELTLPSLG
KPYKSLMAQEKGASRGRGGNESAM
NT seq 1695 nt NT seq  +upstreamnt  +downstreamnt
atgagcagccatggcaacagcctgttcctgcgggagagcggccagcggctgggccgggtg
ggctggctgcagcggctgcaggaaagcctgcagcagagagcactgcgcacgcgcctgcgc
ctgcagaccatgaccctcgagcacgtgctgcgcttcctgcgccgaaacgccttcattctg
ctgacggtcagcgccgtggtcattggggtcagcctggcctttgccctgcgcccatatcag
ctcacctaccgccagatcaagtacttctcttttcctggagagcttctgatgaggatgctg
cagatgctggtgttacctctcattgtctccagcctggtcacaggtatggcatccctggac
aacaaggccacggggcggatggggatgcgggcagctgtgtactacatggtgaccaccatc
atcgcggtcttcatcggcatcctcatggtcaccatcatccatcccgggaagggctccaag
gaggggctgcaccgggagggccggatcgagaccatccccacagctgatgccttcatggac
ctgatcagaaatatgtttccaccaaaccttgtggaggcctgcttcaaacagttcaagacg
cagtacagcacgagggtggtaaccaggaccatggtgaggacagagaacgggtctgagccg
ggtgcctccatgcctcctccattctcagtggagaacggaaccagcttcctggaaaatgtc
actcgggccttgggtaccctgcaggagatgctgagctttgaggagactgtacccgtgcct
ggctccgccaatggcatcaacgccctgggcctcgtggtcttctctgtggcctttgggctg
gtcattggtggcatgaaacacaagggcagagtcctcagggacttcttcgacagcctcaat
gaggctattatgaggctggtgggcatcattatctggtatgcacctgtgggcatcctgttc
ctgattgctgggaagattctggagatggaagacatggccgtcctggggggtcagctgggc
atgtacaccctgaccgtcatcgtgggcctgttcctccatgccggcattgtccttcccctc
atctacttcctcgtcactcaccggaaccccttccccttcattgggggcatgctacaagcc
ctcatcaccgctatgggcacgtcttccagctcggcaacgctgcccatcaccttccgctgc
ctggaggagggcctgggtgtggaccgccgcatcaccaggttcgtcctgcccgtgggcgcc
acggtcaacatggatggcactgccctctacgaggccctggctgccatcttcattgctcaa
gttaacaactacgagctcaacctgggtcagatcacaaccatcagcatcacggccacagca
gccagtgttggggctgctggcatcccccaggcgggtctggtcaccatggtcattgtgctt
acgtcggtcggcttgcccacggaagacatcacgctcatcattgccgtggactggttcctt
gaccggcttcgcacaatgaccaacgtactgggggactcaattggagcggccgtcatcgag
cacttgtctcagcgggagctggagcttcaggaagctgagcttaccctccccagcctgggg
aaaccctacaagtccctcatggcacaggagaagggggcatcccggggacggggaggcaac
gagagtgctatgtga

DBGET integrated database retrieval system