KEGG   Homo sapiens (human): 65110Help
Entry
65110             CDS       T01001                                 

Gene name
UPF3A, HUPF3A, RENT3A, UPF3
Definition
(RefSeq) UPF3A regulator of nonsense mediated mRNA decay
  KO
K14328  regulator of nonsense transcripts 3
Organism
hsa  Homo sapiens (human)
Pathway
hsa03013  RNA transport
hsa03015  mRNA surveillance pathway
Module
hsa_M00430  Exon junction complex (EJC)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    65110 (UPF3A)
   03015 mRNA surveillance pathway
    65110 (UPF3A)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:hsa03019]
    65110 (UPF3A)
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Surveillance factors
    Surveillance complex
     65110 (UPF3A)
   mRNA cycle factors
    P-body specific factors
     65110 (UPF3A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Smg4_UPF3
Motif
Other DBs
NCBI-GeneID: 65110
NCBI-ProteinID: NP_075387
OMIM: 605530
HGNC: 20332
Ensembl: ENSG00000169062
Vega: OTTHUMG00000017403
Pharos: Q9H1J1(Tbio)
UniProt: Q9H1J1
Structure
PDB: 

Position
13q34
AA seq 476 aa AA seqDB search
MRSEKEGAGGLRAAVAARGPSGREKLSALEVQFHRDSQQQEAETPPTSSSGCGGGAGKPR
EEKRTALSKVVIRRLPPGLTKEQLEEQLRPLPAHDYFEFFAADLSLYPHLYSRAYINFRN
PDDILLFRDRFDGYIFLDSKGLEYPAVVEFAPFQKIAKKKLRKKDAKTGSIEDDPEYKKF
LETYCVEEEKTSANPETLLGEMEAKTRELIARRTTPLLEYIKNRKLEKQRIREEKREERR
RRELEKKRLREEEKRRRREEERCKKKETDKQKKIAEKEVRIKLLKKPEKGEEPTTEKPKE
RGEEIDTGGGKQESCAPGAVVKARPMEGSLEEPQETSHSGSDKEHRDVERSQEQESEAQR
YHVDDGRRHRAHHEPERLSRRSEDEQRWGKGPGQDRGKKGSQDSGAPGEAMERLGRAQRC
DDSPAPRKERLANKDRPALQLYDPGARFRARECGGNRRICKAEGSGTGPEKREEAE
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
atgcgctcggaaaaggagggggccggaggccttcgggcggccgttgccgcgcggggcccg
agcgggagggagaagctgtcggccctagaagtgcagttccaccgcgactcgcagcagcag
gaggctgagacgccgccaacttcgtcctccggttgcgggggcggtgcgggcaaacctcgc
gaggagaagaggacggccctgagcaaggtggtcatccgccgcctgcctccgggcctcacc
aaggagcagctggaggagcagctgcgcccgctgccagcacacgactacttcgagttcttc
gccgccgacctgagtctttatcctcatctctactcaagagcatacattaattttaggaat
cctgatgacatccttctttttagagatcgttttgatggatatatcttccttgacagcaaa
ggcctagaatatcctgcagtggtagagtttgctccattccagaagatagccaaaaagaag
ctgagaaaaaaagatgccaagactggaagcatcgaagatgatccagaatataagaagttt
ttagaaacctactgtgtggaggaagagaagaccagtgccaaccctgagactctgctgggg
gagatggaggcgaagacaagagagctcattgctagaagaaccacacctcttttggaatat
attaaaaatagaaaattagaaaagcagagaattcgagaagagaagcgagaagaacggagg
aggagagagttagaaaagaaacgtttgcgggaagaggaaaaaagaagaagaagagaagaa
gaaagatgcaaaaaaaaagagacagataaacagaagaaaattgcagagaaagaagtaagg
attaagcttcttaagaaaccagaaaagggagaggaaccaaccacagagaaaccaaaagaa
agaggagaggagattgatactggaggtggcaagcaggaatcctgtgcccccggtgcagtc
gtaaaagccaggcccatggaaggctcgctggaggagccccaggagacgtcacacagcggc
agtgataaagagcacagggatgtggagagatctcaagaacaagaatctgaagcacaaaga
taccatgtggatgacggcaggaggcacagagctcaccacgagcctgaacggctttccaga
aggagtgaggatgagcagagatgggggaaaggacctggccaagacagagggaagaagggg
agccaggacagcggggctccgggggaggccatggagagactgggaagagcgcagaggtgt
gacgacagtccagcacccagaaaagagcgactggcaaacaaggaccggccagccttgcag
ctgtatgatccaggagctcgcttccgagcgcgagagtgtggcggaaacaggaggatctgc
aaggcagaaggttcggggactggtcctgagaagagggaagaggcagagtga

DBGET integrated database retrieval system