KEGG   Homo sapiens (human): 6512Help
Entry
6512              CDS       T01001                                 

Gene name
SLC1A7, AAAT, EAAT5
Definition
(RefSeq) solute carrier family 1 member 7
  KO
K05618  solute carrier family 1 (glutamate transporter), member 7
Organism
hsa  Homo sapiens (human)
Pathway
hsa04721  Synaptic vesicle cycle
hsa04724  Glutamatergic synapse
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09156 Nervous system
   04724 Glutamatergic synapse
    6512 (SLC1A7)
   04721 Synaptic vesicle cycle
    6512 (SLC1A7)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    6512 (SLC1A7)
Transporters [BR:hsa02000]
 Solute carrier family (SLC)
  SLC1: High-affinity glutamate and neutral amino acid transporter
   6512 (SLC1A7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SDF DUF2417
Motif
Other DBs
NCBI-GeneID: 6512
NCBI-ProteinID: NP_006662
OMIM: 604471
HGNC: 10945
Ensembl: ENSG00000162383
Vega: OTTHUMG00000008937
Pharos: O00341(Tchem)
UniProt: O00341 F1T0D3
Position
1p32.3
AA seq 560 aa AA seqDB search
MVPHAILARGRDVCRRNGLLILSVLSVIVGCLLGFFLRTRRLSPQEISYFQFPGELLMRM
LKMMILPLVVSSLMSGLASLDAKTSSRLGVLTVAYYLWTTFMAVIVGIFMVSIIHPGSAA
QKETTEQSGKPIMSSADALLDLIRNMFPANLVEATFKQYRTKTTPVVKSPKVAPEEAPPR
RILIYGVQEENGSHVQNFALDLTPPPEVVYKSEPGTSDGMNVLGIVFFSATMGIMLGRMG
DSGAPLVSFCQCLNESVMKIVAVAVWYFPFGIVFLIAGKILEMDDPRAVGKKLGFYSVTV
VCGLVLHGLFILPLLYFFITKKNPIVFIRGILQALLIALATSSSSATLPITFKCLLENNH
IDRRIARFVLPVGATINMDGTALYEAVAAIFIAQVNNYELDFGQIITISITATAASIGAA
GIPQAGLVTMVIVLTSVGLPTDDITLIIAVDWALDRFRTMINVLGDALAAGIMAHICRKD
FARDTGTEKLLPCETKPVSLQEIVAAQQNGCVKSVAEASELTLGPTCPHHVPVQVEQDEE
LPAASLNHCTIQISELETNV
NT seq 1683 nt NT seq  +upstreamnt  +downstreamnt
atggtgccgcatgccatcttggcacgggggagggacgtgtgcaggcggaatggactcctc
atcctgtctgtgctgtctgtcatcgtgggctgcctcctcggcttcttcttgaggacccgg
cgcctctcaccacaggaaattagttacttccagttccctggagagctcctgatgaggatg
ctgaagatgatgatcctgccactggtggtctccagcttgatgtccggacttgcctccctg
gatgccaagacctctagccgcctgggcgtcctcaccgtggcgtactacctgtggaccacc
ttcatggctgtcatcgtgggcatcttcatggtctccatcatccacccaggcagcgcggcc
cagaaggagaccacggagcagagtgggaagcccatcatgagctcagccgatgccctgttg
gacctcatccggaacatgttcccagccaacctagtagaagccacattcaaacagtaccgc
accaagaccaccccagttgtcaagtcccccaaggtggcaccagaggaggcccctcctcgg
cggatcctcatctacggggtccaggaggagaatggctcccatgtgcagaacttcgccctg
gacctgaccccgccgcccgaggtcgtttacaagtcagagccgggcaccagcgatggcatg
aatgtgctgggcatcgtcttcttctctgccaccatgggcatcatgctgggccgcatgggt
gacagcggggcccccctggtcagcttctgccagtgcctcaatgagtcggtcatgaagatc
gtggcggtggctgtgtggtatttccccttcggcattgtgttcctcattgcgggtaagatc
ctggagatggacgaccccagggccgtcggcaagaagctgggcttctactcagtcaccgtg
gtgtgcgggctggtgctccacgggctctttatcctgcccctgctctacttcttcatcacc
aagaagaatcccatcgtcttcatccgtggcatcctgcaggctctgctcatcgcgctggcc
acctcctccagctcagccacactgcccatcaccttcaagtgcctgctggagaacaaccac
atcgaccggcgcatcgctcgcttcgtgctgcccgtgggtgccaccatcaacatggacggc
actgcgctctacgaggctgtggccgccatcttcatcgcccaggtcaacaactacgagctg
gactttggccagatcatcaccatcagtatcacagccactgcagccagcattggggcagct
ggcatcccccaggccggcctcgtcaccatggtcatcgtgctcacctccgtgggactgccc
accgatgacatcaccctcatcattgccgttgactgggctctggaccgtttccgcaccatg
attaacgtgctgggtgatgcgctggcagcggggatcatggcccatatatgtcggaaggat
tttgcccgggacacaggcaccgagaaactgctgccctgcgagaccaagccagtgagcctc
caggagatcgtggcagcccagcagaatggctgtgtgaagagtgtagccgaggcctccgag
ctcaccctgggccccacctgcccccaccacgtccccgttcaagtggagcaggatgaggag
ctgcccgctgcgagtctgaaccactgcaccatccagatcagtgagctggagaccaatgtc
tga

DBGET integrated database retrieval system