KEGG   Homo sapiens (human): 65125Help
Entry
65125             CDS       T01001                                 

Gene name
WNK1, HSAN2, HSN2, KDP, PPP1R167, PRKWNK1, PSK, p65
Definition
(RefSeq) WNK lysine deficient protein kinase 1
  KO
K08867  WNK lysine deficient protein kinase [EC:2.7.11.1]
Organism
hsa  Homo sapiens (human)
Disease
H00243  Hyperkalemic distal renal tubular acidosis (RTA type 4)
H00265  Hereditary sensory and autonomic neuropathy
H02310  Renal tubular acidosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    65125 (WNK1)
   01009 Protein phosphatases and associated proteins [BR:hsa01009]
    65125 (WNK1)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     65125 (WNK1)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: Other
  Wnk family
   65125 (WNK1)
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     65125 (WNK1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr OSR1_C Pkinase_fungal
Motif
Other DBs
NCBI-GeneID: 65125
NCBI-ProteinID: NP_061852
OMIM: 605232
HGNC: 14540
Ensembl: ENSG00000060237
Vega: OTTHUMG00000090321
Pharos: Q9H4A3(Tbio)
UniProt: Q9H4A3 A5D8Z4
Structure
PDB: 

Position
12p13.33
AA seq 2382 aa AA seqDB search
MSGGAAEKQSSTPGSLFLSPPAPAPKNGSSSDSSVGEKLGAAAADAVTGRTEEYRRRRHT
MDKDSRGAAATTTTTEHRFFRRSVICDSNATALELPGLPLSLPQPSIPAAVPQSAPPEPH
REETVTATATSQVAQQPPAAAAPGEQAVAGPAPSTVPSSTSKDRPVSQPSLVGSKEEPPP
ARSGSGGGSAKEPQEERSQQQDDIEELETKAVGMSNDGRFLKFDIEIGRGSFKTVYKGLD
TETTVEVAWCELQDRKLTKSERQRFKEEAEMLKGLQHPNIVRFYDSWESTVKGKKCIVLV
TELMTSGTLKTYLKRFKVMKIKVLRSWCRQILKGLQFLHTRTPPIIHRDLKCDNIFITGP
TGSVKIGDLGLATLKRASFAKSVIGTPEFMAPEMYEEKYDESVDVYAFGMCMLEMATSEY
PYSECQNAAQIYRRVTSGVKPASFDKVAIPEVKEIIEGCIRQNKDERYSIKDLLNHAFFQ
EETGVRVELAEEDDGEKIAIKLWLRIEDIKKLKGKYKDNEAIEFSFDLERDVPEDVAQEM
VESGYVCEGDHKTMAKAIKDRVSLIKRKREQRQLVREEQEKKKQEESSLKQQVEQSSASQ
TGIKQLPSASTGIPTASTTSASVSTQVEPEEPEADQHQQLQYQQPSISVLSDGTVDSGQG
SSVFTESRVSSQQTVSYGSQHEQAHSTGTVPGHIPSTVQAQSQPHGVYPPSSVAQGQSQG
QPSSSSLTGVSSSQPIQHPQQQQGIQQTAPPQQTVQYSLSQTSTSSEATTAQPVSQPQAP
QVLPQVSAGKQLPVSQPVPTIQGEPQIPVATQPSVVPVHSGAHFLPVGQPLPTPLLPQYP
VSQIPISTPHVSTAQTGFSSLPITMAAGITQPLLTLASSATTAAIPGVSTVVPSQLPTLL
QPVTQLPSQVHPQLLQPAVQSMGIPANLGQAAEVPLSSGDVLYQGFPPRLPPQYPGDSNI
APSSNVASVCIHSTVLSPPMPTEVLATPGYFPTVVQPYVESNLLVPMGGVGGQVQVSQPG
GSLAQAPTTSSQQAVLESTQGVSQVAPAEPVAVAQTQATQPTTLASSVDSAHSDVASGMS
DGNENVPSSSGRHEGRTTKRHYRKSVRSRSRHEKTSRPKLRILNVSNKGDRVVECQLETH
NRKMVTFKFDLDGDNPEEIATIMVNNDFILAIERESFVDQVREIIEKADEMLSEDVSVEP
EGDQGLESLQGKDDYGFSGSQKLEGEFKQPIPASSMPQQIGIPTSSLTQVVHSAGRRFIV
SPVPESRLRESKVFPSEITDTVAASTAQSPGMNLSHSASSLSLQQAFSELRRAQMTEGPN
TAPPNFSHTGPTFPVVPPFLSSIAGVPTTAAATAPVPATSSPPNDISTSVIQSEVTVPTE
EGIAGVATSTGVVTSGGLPIPPVSESPVLSSVVSSITIPAVVSISTTSPSLQVPTSTSEI
VVSSTALYPSVTVSATSASAGGSTATPGPKPPAVVSQQAAGSTTVGATLTSVSTTTSFPS
TASQLCIQLSSSTSTPTLAETVVVSAHSLDKTSHSSTTGLAFSLSAPSSSSSPGAGVSSY
ISQPGGLHPLVIPSVIASTPILPQAAGPTSTPLLPQVPSIPPLVQPVANVPAVQQTLIHS
QPQPALLPNQPHTHCPEVDSDTQPKAPGIDDIKTLEEKLRSLFSEHSSSGAQHASVSLET
SLVIESTVTPGIPTTAVAPSKLLTSTTSTCLPPTNLPLGTVALPVTPVVTPGQVSTPVST
TTSGVKPGTAPSKPPLTKAPVLPVGTELPAGTLPSEQLPPFPGPSLTQSQQPLEDLDAQL
RRTLSPEMITVTSAVGPVSMAAPTAITEAGTQPQKGVSQVKEGPVLATSSGAGVFKMGRF
QVSVAADGAQKEGKNKSEDAKSVHFESSTSESSVLSSSSPESTLVKPEPNGITIPGISSD
VPESAHKTTASEAKSDTGQPTKVGRFQVTTTANKVGRFSVSKTEDKITDTKKEGPVASPP
FMDLEQAVLPAVIPKKEKPELSEPSHLNGPSSDPEAAFLSRDVDDGSGSPHSPHQLSSKS
LPSQNLSQSLSNSFNSSYMSSDNESDIEDEDLKLELRRLRDKHLKEIQDLQSRQKHEIES
LYTKLGKVPPAVIIPPAAPLSGRRRRPTKSKGSKSSRSSSLGNKSPQLSGNLSGQSAASV
LHPQQTLHPPGNIPESGQNQLLQPLKPSPSSDNLYSAFTSDGAISVPSLSAPGQGTSSTN
TVGATVNSQAAQAQPPAMTSSRKGTFTDDLHKLVDNWARDAMNLSGRRGSKGHMNYEGPG
MARKFSAPGQLCISMTSNLGGSAPISAASATSLGHFTKSMCPPQQYGFPATPFGAQWSGT
GGPAPQPLGQFQPVGTASLQNFNISNLQKSISNPPGSNLRTT
NT seq 7149 nt NT seq  +upstreamnt  +downstreamnt
atgtctggcggcgccgcagagaagcagagcagcactcccggttccctgttcctctcgccg
ccggctcctgcccccaagaatggctccagctccgattcctccgtgggggagaaactggga
gccgcggccgccgacgctgtgaccggcaggaccgaggagtacaggcgccgccgccacact
atggacaaggacagccgtggggcggccgcgaccactaccaccactgagcaccgcttcttc
cgccggagcgtcatctgtgactccaatgccactgcactggagcttcccggccttcctctt
tccctgccccagcccagcatccccgcggctgtcccgcagagtgctccaccggagccccac
cgggaagagaccgtgaccgccaccgccacttcccaggtagcccagcagcctccagccgct
gccgcccctggggaacaggccgtcgcgggccctgccccctcgactgtccccagcagtacc
agcaaagaccgcccagtgtcccagcctagccttgtggggagcaaagaggagccgccgccg
gcgagaagtggcagcggcggcggcagcgccaaggagccacaggaggaacggagccagcag
caggatgatatcgaagagctggagaccaaggccgtgggaatgtctaacgatggccgcttt
ctcaagtttgacatcgaaatcggcagaggctcctttaagacggtctacaaaggtctggac
actgaaaccaccgtggaagtcgcctggtgtgaactgcaggatcgaaaattaacaaagtct
gagaggcagagatttaaagaagaagctgaaatgttaaaaggtcttcagcatcccaatatt
gttagattttatgattcctgggaatccacagtaaaaggaaagaagtgcattgttttggtg
actgaacttatgacgtctggaacacttaaaacgtatctgaaaaggtttaaagtgatgaag
atcaaagttctaagaagctggtgccgtcagatccttaaaggtcttcagtttcttcatact
cgaactccacctatcattcaccgcgatcttaaatgtgacaacatctttatcaccggccct
actggctcagtcaagattggagacctcggtctggcaaccctgaagcgggcttcttttgcc
aagagtgtgataggtaccccagagttcatggcccctgagatgtatgaggagaaatatgat
gaatccgttgacgtttatgcttttgggatgtgcatgcttgagatggctacatctgaatat
ccttactcggagtgccaaaatgctgcacagatctaccgtcgcgtgaccagtggggtgaag
ccagccagttttgacaaagtagcaattcctgaagtgaaggaaattattgaaggatgcata
cgacaaaacaaagatgaaagatattccatcaaagaccttttgaaccatgccttcttccaa
gaggaaacaggagtacgggtagaattagcagaagaagatgatggagaaaaaatagccata
aaattatggctacgtattgaagatattaagaaattaaagggaaaatacaaagataatgaa
gctattgagttttcttttgatttagagagagatgtcccagaagatgttgcacaagaaatg
gtagagtctgggtatgtctgtgaaggtgatcacaagaccatggctaaagctatcaaagac
agagtatcattaattaagaggaaacgagagcagcggcagttggtacgggaggagcaagaa
aaaaaaaagcaggaagagagcagtctcaaacagcaggtagaacaatccagtgcttcccag
acaggaatcaagcagctcccttctgctagcaccggcatacctactgcttctaccacttca
gcttcagtttctacacaagtagaacctgaagaacctgaggcagatcaacatcaacaacta
cagtaccagcaacccagtatatctgtgttatctgatgggacggttgacagtggtcaggga
tcctctgtcttcacagaatctcgagtgagcagccaacagacagtttcatatggttcccaa
catgaacaggcacattctacaggcacagtcccagggcatataccttctactgtccaagca
cagtctcagccccatggggtatatccaccctcaagtgtggcacaggggcagagccagggt
cagccatcctcaagtagcttaacaggggtttcatcttcccaacccatacaacatcctcag
cagcagcagggaatacagcagacagcccctcctcaacagacagtgcagtattcactttca
cagacatcaacctccagtgaggccactactgcacagccagtgagtcagcctcaagctcca
caagtcttgcctcaagtatcagctggaaaacagcttccagtttcccagccagtaccaact
atccaaggcgaacctcagatcccagttgcgacacaaccctcggttgttccagtccactct
ggtgctcatttccttccagtgggacagccgctccctactcccttgctccctcagtaccct
gtctctcagattcccatatcaactcctcatgtgtctacggctcagacaggtttctcatcc
cttcccatcacaatggcagctggcattactcagcctctgctcacgttggcttcatctgct
acaacagctgcgatcccgggggtatcaactgtggttcctagtcagcttccaacccttctg
cagcctgtgactcagctgccaagtcaggttcacccacagctcctacaaccagcagttcag
tccatgggaataccagctaaccttggacaagctgctgaggttccactttcctctggagat
gttctgtaccagggcttcccacctcgactgccaccacagtacccaggagattcaaatatt
gctccctcttccaacgtggcttctgtttgcatccattctacagtcctatcccctcccatg
ccgacagaagtactggctacacctgggtactttcccacagtggtgcagccttatgtggaa
tcaaatcttttagttcctatgggtggtgtaggaggacaggttcaagtgtcccagccagga
gggagtttagcacaagcccccactacatcctcccagcaagcagttttggagagtactcag
ggagtctctcaggttgctcctgcagagccagttgcagtagcacagacccaagctacccag
ccgaccactttggcttcctctgtagacagtgcacattcagatgttgcttcaggtatgagt
gatggcaatgagaacgtcccatcttccagtggaaggcatgaaggaagaactacaaaacgg
cattaccgaaaatctgtaaggagtcgctctcgacatgaaaaaacttcacgcccaaaatta
agaattttgaatgtttcaaataaaggagaccgagtagtagaatgtcaattagagactcat
aataggaaaatggttacattcaaatttgacctagatggtgacaaccccgaggagatagca
acaattatggtgaacaatgactttattctagcaatagagagagagtcgtttgtggatcaa
gtgcgagaaattattgaaaaagctgatgaaatgctcagtgaggatgtcagtgtggaacca
gagggtgatcagggattggagagtctacaaggaaaggatgactatggcttttcaggttct
cagaaattggaaggagagttcaaacaaccaattcctgcgtcttccatgccacagcaaata
ggcattcctaccagttctttaactcaagttgttcattctgcgggaaggcggtttatagtg
agtcctgtgccagaaagccgattacgagaatcaaaagttttccccagtgaaataacagat
acagttgctgcctctacagctcagagccctggaatgaacttgtctcactctgcatcatcc
cttagtctacaacaggccttttctgaacttagacgtgcccaaatgacagaaggacccaac
acagcacctccaaactttagtcatacaggaccaacatttccagtagtacctcctttctta
agtagcattgctggagtcccaaccacagcagcagccacagcaccagtccctgcaacaagc
agccctcctaatgacatttccacatcagtaattcagtctgaggttacagtgcccactgaa
gaggggattgctggagttgccaccagcacaggtgtggtaacttcaggtggtctccccata
ccacctgtgtctgaatcaccagtactttccagcgtagtttcaagtatcacaatacctgca
gttgtctcaatatctactacatccccgtcacttcaagtccccacatccacatctgagatc
gttgtttctagtacagcactgtatccttcagtaacagtttcagcaacttcagcctctgca
gggggcagtactgctaccccaggtcctaagcctccagctgtagtatctcagcaggcagca
ggcagcactactgtgggagccacattaacatcagtttctaccaccacttcattcccaagc
acagcttcacagctgtgcattcagcttagcagcagtacttctactcctactttagctgaa
accgtggtagttagcgcacactcactagataagacatctcatagcagtacaactggattg
gctttctccctctctgcaccatcttcctcttcctctcctggagcaggagtgtctagttat
atttctcagcctggtgggctgcatcctttggtcattccatcagtgatagcttctactcct
attcttccccaagcagcaggacctacttctacacctttattaccccaagtacctagtatc
ccacccttggtacagcctgttgccaatgtgcctgctgtacagcagacactaattcatagt
cagcctcaaccagctttgcttcccaaccagccccatactcattgtcctgaagtagattct
gatacacaacccaaagctcctggaattgatgacataaagactctagaagaaaagctgcgg
tctctgttcagtgaacacagctcatctggagctcagcatgcctctgtctcactggagacc
tcactagtcatagagagcactgtcacaccaggcatcccaactactgctgttgcaccaagc
aaactcctgacttctaccacaagtacttgcttaccaccaaccaatttaccactaggaaca
gttgctttgccagttacaccagtggtcacacctgggcaagtttctaccccagtcagcact
actacatcaggagtgaaacctggaactgctccctccaagccacctctaactaaggctccg
gtgctgccagtgggtactgaacttccagcaggtactctacccagcgagcagctgccacct
tttccaggaccttctctaacccagtcccagcaacctctagaggatcttgatgctcaattg
agaagaacacttagtccagagatgatcacagtgacttctgcggttggtcctgtgtccatg
gcggctccaacagcaatcacagaagcaggaacacagcctcagaagggtgtttctcaagtc
aaagaaggccctgtcctagcaactagttcaggagctggtgtttttaagatgggacgattt
caggtttctgttgcagcagacggtgcccagaaagagggtaaaaataagtcagaagatgca
aagtctgttcattttgaatccagcacctcagagtcctcagtgctatcaagtagtagtcca
gagagtaccttggtgaaaccagagccgaatggcataaccatccctggtatctcttcagat
gtgccagagagtgcccacaaaactactgcctcagaggcaaagtcagacactgggcagcct
accaaggttggacgttttcaggtgacaactacagcaaacaaagtgggtcgtttctctgta
tcaaaaactgaggacaagatcactgacacaaagaaagaaggaccagtggcatctcctcct
tttatggatttggaacaagctgttcttcctgctgtgataccaaagaaagagaagcctgaa
ctgtcagagccttcacatctaaatgggccgtcttctgacccggaggccgcttttttaagt
agggatgtggatgatggttccggtagtccacactcgccccatcagctgagctcaaagagc
cttcctagccagaatctaagtcaaagccttagtaattcatttaactcctcttacatgagt
agcgacaatgagtcagatatcgaagatgaagacttaaagttagagctgcgacgactacga
gataaacatctcaaagagattcaggacctgcagagtcgccagaagcatgaaattgaatct
ttgtataccaaactgggcaaggtgccccctgctgttattattcccccagctgctcccctt
tcagggagaagacgacgacccactaaaagcaaaggcagcaaatctagtcgaagcagttcc
ttggggaataaaagcccccagctttcaggtaacctgtctggtcagagtgcagcttcagtc
ttgcacccccagcagaccctccaccctcctggcaacatcccagagtccgggcagaatcag
ctgttacagccccttaagccatctccctccagtgacaacctctattcagccttcaccagt
gatggtgccatttcagtaccaagcctttctgctccaggtcaaggaaccagcagcacaaac
actgttggggcaacagtgaacagccaagccgcccaagctcagcctcctgccatgacgtcc
agcaggaagggcacattcacagatgacttgcacaagttggtagacaattgggcccgagat
gccatgaatctctcaggcaggagaggaagcaaagggcacatgaattacgagggccctgga
atggcaaggaagttctctgcacctgggcaactgtgcatctccatgacctcgaacctgggt
ggctctgcccccatctctgcagcatcagctacctctctaggtcacttcaccaagtctatg
tgccccccacagcagtatggctttccagctaccccatttggcgctcaatggagtgggacg
ggtggcccagcaccacagccacttggccagttccaacctgtgggaactgcctccttgcag
aatttcaacatcagcaatttgcagaaatccatcagcaaccccccaggctccaacctgcgg
accacttag

DBGET integrated database retrieval system