KEGG   Homo sapiens (human): 6515
Entry
6515              CDS       T01001                                 

Symbol
SLC2A3, GLUT3
Name
(RefSeq) solute carrier family 2 member 3
  KO
K08142  MFS transporter, SP family, solute carrier family 2 (facilitated glucose transporter), member 3
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    6515 (SLC2A3)
Transporters [BR:hsa02000]
 Solute carrier family (SLC)
  SLC2: Facilitative GLUT transporter
   6515 (SLC2A3)
 Major facilitator superfamily (MFS)
  Sugar transporters
   Sugar porter (SP) family [TC:2.A.1.1]
    6515 (SLC2A3)
SSDB
Motif
Pfam: Sugar_tr MFS_1 DUF523
Other DBs
NCBI-GeneID: 6515
NCBI-ProteinID: NP_008862
OMIM: 138170
HGNC: 11007
Ensembl: ENSG00000059804
Vega: OTTHUMG00000133685
Pharos: P11169(Tbio)
UniProt: P11169
Structure
PDB: 
4ZW9 4ZWB 4ZWC 5C65

Position
12p13.31
AA seq 496 aa
MGTQKVTPALIFAITVATIGSFQFGYNTGVINAPEKIIKEFINKTLTDKGNAPPSEVLLT
SLWSLSVAIFSVGGMIGSFSVGLFVNRFGRRNSMLIVNLLAVTGGCFMGLCKVAKSVEML
ILGRLVIGLFCGLCTGFVPMYIGEISPTALRGAFGTLNQLGIVVGILVAQIFGLEFILGS
EELWPLLLGFTILPAILQSAALPFCPESPRFLLINRKEEENAKQILQRLWGTQDVSQDIQ
EMKDESARMSQEKQVTVLELFRVSSYRQPIIISIVLQLSQQLSGINAVFYYSTGIFKDAG
VQEPIYATIGAGVVNTIFTVVSLFLVERAGRRTLHMIGLGGMAFCSTLMTVSLLLKDNYN
GMSFVCIGAILVFVAFFEIGPGPIPWFIVAELFSQGPRPAAMAVAGCSNWTSNFLVGLLF
PSAAHYLGAYVFIIFTGFLITFLAFTFFKVPETRGRTFEDITRAFEGQAHGADRSGKDGV
MEMNSIEPAKETTTNV
NT seq 1491 nt   +upstreamnt  +downstreamnt
atggggacacagaaggtcaccccagctctgatatttgccatcacagttgctacaatcggc
tctttccaatttggctacaacactggggtcatcaatgctcctgagaagatcataaaggaa
tttatcaataaaactttgacggacaagggaaatgccccaccctctgaggtgctgctcacg
tctctctggtccttgtctgtggccatattttccgtcgggggtatgatcggctccttttcc
gtcggactcttcgtcaaccgctttggcaggcgcaattcaatgctgattgtcaacctgttg
gctgtcactggtggctgctttatgggactgtgtaaagtagctaagtcggttgaaatgctg
atcctgggtcgcttggttattggcctcttctgcggactctgcacaggttttgtgcccatg
tacattggagagatctcgcctactgccctgcggggtgcctttggcactctcaaccagctg
ggcatcgttgttggaattctggtggcccagatctttggtctggaattcatccttgggtct
gaagagctatggccgctgctactgggttttaccatccttcctgctatcctacaaagtgca
gcccttccattttgccctgaaagtcccagatttttgctcattaacagaaaagaagaggag
aatgctaagcagatcctccagcggttgtggggcacccaggatgtatcccaagacatccag
gagatgaaagatgagagtgcaaggatgtcacaagaaaagcaagtcaccgtgctagagctc
tttagagtgtccagctaccgacagcccatcatcatttccattgtgctccagctctctcag
cagctctctgggatcaatgctgtgttctattactcaacaggaatcttcaaggatgcaggt
gttcaagagcccatctatgccaccatcggcgcgggtgtggttaatactatcttcactgta
gtttctctatttctggtggaaagggcaggaagaaggactctgcatatgataggccttgga
gggatggctttttgttccacgctcatgactgtttctttgttattaaaggataactataat
gggatgagctttgtctgtattggggctatcttggtctttgtagccttctttgaaattgga
ccaggccccattccctggtttattgtggccgaactcttcagccagggcccccgcccagct
gcgatggcagtggccggctgctccaactggacctccaacttcctagtcggattgctcttc
ccctccgctgctcactatttaggagcctacgtttttattatcttcaccggcttcctcatt
accttcttggcttttaccttcttcaaagtccctgagacccgtggcaggacttttgaggat
atcacacgggcctttgaagggcaggcacacggtgcagatagatctggaaaggacggcgtc
atggagatgaacagcatcgagcctgctaaggagaccaccaccaatgtctaa

DBGET integrated database retrieval system