KEGG   Homo sapiens (human): 6520Help
Entry
6520              CDS       T01001                                 

Gene name
SLC3A2, 4F2, 4F2HC, 4T2HC, CD98, CD98HC, MDU1, NACAE
Definition
(RefSeq) solute carrier family 3 member 2
  KO
K06519  solute carrier family 3, member 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04150  mTOR signaling pathway
hsa04216  Ferroptosis
hsa04974  Protein digestion and absorption
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04150 mTOR signaling pathway
    6520 (SLC3A2)
 09140 Cellular Processes
  09143 Cell growth and death
   04216 Ferroptosis
    6520 (SLC3A2)
 09150 Organismal Systems
  09154 Digestive system
   04974 Protein digestion and absorption
    6520 (SLC3A2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    6520 (SLC3A2)
   04147 Exosome [BR:hsa04147]
    6520 (SLC3A2)
   04090 CD molecules [BR:hsa04090]
    6520 (SLC3A2)
Transporters [BR:hsa02000]
 Solute Carrier Family (SLC)
  SLC3: Heavy subunits of the heteromeric amino acid transporters
   6520 (SLC3A2)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   6520 (SLC3A2)
CD molecules [BR:hsa04090]
 Proteins
  6520 (SLC3A2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SLC3A2_N Alpha-amylase DUF3459
Motif
Other DBs
NCBI-GeneID: 6520
NCBI-ProteinID: NP_002385
OMIM: 158070
HGNC: 11026
Ensembl: ENSG00000168003
Vega: OTTHUMG00000074091
Pharos: P08195(Tbio)
UniProt: P08195
Structure
PDB: 

Position
11q12.3
AA seq 630 aa AA seqDB search
MELQPPEASIAVVSIPRQLPGSHSEAGVQGLSAGDDSELGSHCVAQTGLELLASGDPLPS
ASQNAEMIETGSDCVTQAGLQLLASSDPPALASKNAEVTGTMSQDTEVDMKEVELNELEP
EKQPMNAASGAAMSLAGAEKNGLVKIKVAEDEAEAAAAAKFTGLSKEELLKVAGSPGWVR
TRWALLLLFWLGWLGMLAGAVVIIVRAPRCRELPAQKWWHTGALYRIGDLQAFQGHGAGN
LAGLKGRLDYLSSLKVKGLVLGPIHKNQKDDVAQTDLLQIDPNFGSKEDFDSLLQSAKKK
SIRVILDLTPNYRGENSWFSTQVDTVATKVKDALEFWLQAGVDGFQVRDIENLKDASSFL
AEWQNITKGFSEDRLLIAGTNSSDLQQILSLLESNKDLLLTSSYLSDSGSTGEHTKSLVT
QYLNATGNRWCSWSLSQARLLTSFLPAQLLRLYQLMLFTLPGTPVFSYGDEIGLDAAALP
GQPMEAPVMLWDESSFPDIPGAVSANMTVKGQSEDPGSLLSLFRRLSDQRSKERSLLHGD
FHAFSAGPGLFSYIRHWDQNERFLVVLNFGDVGLSAGLQASDLPASASLPAKADLLLSTQ
PGREEGSPLELERLKLEPHEGLLLRFPYAA
NT seq 1893 nt NT seq  +upstreamnt  +downstreamnt
atggagctacagcctcctgaagcctcgatcgccgtcgtgtcgattccgcgccagttgcct
ggctcacattcggaggctggtgtccagggtctcagcgcgggggacgactcagagttgggg
tctcactgtgttgcccagactggtctcgaactcttggcctcaggtgatcctcttccctca
gcttcccagaatgccgagatgatagagacggggtctgactgtgttacccaggctggtctt
caactcttggcctcaagtgatcctcctgccttagcttccaagaatgctgaggttacaggc
accatgagccaggacaccgaggtggatatgaaggaggtggagctgaatgagttagagccc
gagaagcagccgatgaacgcggcgtctggggcggccatgtccctggcgggagccgagaag
aatggtctggtgaagatcaaggtggcggaagacgaggcggaggcggcagccgcggctaag
ttcacgggcctgtccaaggaggagctgctgaaggtggcaggcagccccggctgggtacgc
acccgctgggcactgctgctgctcttctggctcggctggctcggcatgcttgctggtgcc
gtggtcataatcgtgcgagcgccgcgttgtcgcgagctaccggcgcagaagtggtggcac
acgggcgccctctaccgcatcggcgaccttcaggccttccagggccacggcgcgggcaac
ctggcgggtctgaaggggcgtctcgattacctgagctctctgaaggtgaagggccttgtg
ctgggtccaattcacaagaaccagaaggatgatgtcgctcagactgacttgctgcagatc
gaccccaattttggctccaaggaagattttgacagtctcttgcaatcggctaaaaaaaag
agcatccgtgtcattctggaccttactcccaactaccggggtgagaactcgtggttctcc
actcaggttgacactgtggccaccaaggtgaaggatgctctggagttttggctgcaagct
ggcgtggatgggttccaggttcgggacatagagaatctgaaggatgcatcctcattcttg
gctgagtggcaaaatatcaccaagggcttcagtgaagacaggctcttgattgcggggact
aactcctccgaccttcagcagatcctgagcctactcgaatccaacaaagacttgctgttg
actagctcatacctgtctgattctggttctactggggagcatacaaaatccctagtcaca
cagtatttgaatgccactggcaatcgctggtgcagctggagtttgtctcaggcaaggctc
ctgacttccttcttgccggctcaacttctccgactctaccagctgatgctcttcaccctg
ccagggacccctgttttcagctacggggatgagattggcctggatgcagctgcccttcct
ggacagcctatggaggctccagtcatgctgtgggatgagtccagcttccctgacatccca
ggggctgtaagtgccaacatgactgtgaagggccagagtgaagaccctggctccctcctt
tccttgttccggcggctgagtgaccagcggagtaaggagcgctccctactgcatggggac
ttccacgcgttctccgctgggcctggactcttctcctatatccgccactgggaccagaat
gagcgttttctggtagtgcttaactttggggatgtgggcctctcggctggactgcaggcc
tccgacctgcctgccagcgccagcctgccagccaaggctgacctcctgctcagcacccag
ccaggccgtgaggagggctcccctcttgagctggaacgcctgaaactggagcctcacgaa
gggctgctgctccgcttcccctacgcggcctga

DBGET integrated database retrieval system