KEGG   Homo sapiens (human): 6524Help
Entry
6524              CDS       T01001                                 

Gene name
SLC5A2, SGLT2
Definition
(RefSeq) solute carrier family 5 member 2
  KO
K14382  solute carrier family 5 (sodium/glucose cotransporter), member 2
Organism
hsa  Homo sapiens (human)
Disease
H01126  Familial renal glucosuria (FRG)
Drug target
Bexagliflozin: D10865
Canagliflozin: D09592
Dapagliflozin (DG00122): D08897 D09763
Empagliflozin: D10459
Ertugliflozin (DG02836): D10313 D11043
Ipragliflozin (DG01248): D10196 D10200
Luseogliflozin hydrate: D10195
Remogliflozin etabonate: D10055
Sergliflozin etabonate: D06641
Sotagliflozin: D10669
Tofogliflozin: D09978
Brite
Transporters [BR:hsa02000]
 Solute Carrier Family (SLC)
  SLC5: Sodium glucose cotransporter
   6524 (SLC5A2)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   6524 (SLC5A2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SSF
Motif
Other DBs
NCBI-GeneID: 6524
NCBI-ProteinID: NP_003032
OMIM: 182381
HGNC: 11037
Ensembl: ENSG00000140675
Vega: OTTHUMG00000176620
Pharos: P31639(Tclin)
UniProt: P31639
Position
16p11.2
AA seq 672 aa AA seqDB search
MEEHTEAGSAPEMGAQKALIDNPADILVIAAYFLLVIGVGLWSMCRTNRGTVGGYFLAGR
SMVWWPVGASLFASNIGSGHFVGLAGTGAASGLAVAGFEWNALFVVLLLGWLFAPVYLTA
GVITMPQYLRKRFGGRRIRLYLSVLSLFLYIFTKISVDMFSGAVFIQQALGWNIYASVIA
LLGITMIYTVTGGLAALMYTDTVQTFVILGGACILMGYAFHEVGGYSGLFDKYLGAATSL
TVSEDPAVGNISSFCYRPRPDSYHLLRHPVTGDLPWPALLLGLTIVSGWYWCSDQVIVQR
CLAGKSLTHIKAGCILCGYLKLTPMFLMVMPGMISRILYPDEVACVVPEVCRRVCGTEVG
CSNIAYPRLVVKLMPNGLRGLMLAVMLAALMSSLASIFNSSSTLFTMDIYTRLRPRAGDR
ELLLVGRLWVVFIVVVSVAWLPVVQAAQGGQLFDYIQAVSSYLAPPVSAVFVLALFVPRV
NEQGAFWGLIGGLLMGLARLIPEFSFGSGSCVQPSACPAFLCGVHYLYFAIVLFFCSGLL
TLTVSLCTAPIPRKHLHRLVFSLRHSKEEREDLDADEQQGSSLPVQNGCPESAMEMNEPQ
APAPSLFRQCLLWFCGMSRGGVGSPPPLTQEEAAAAARRLEDISEDPSWARVVNLNALLM
MAVAVFLWGFYA
NT seq 2019 nt NT seq  +upstreamnt  +downstreamnt
atggaggagcacacagaggcaggctcggcaccagagatgggggcccagaaggccctgatt
gacaatcctgctgacatcctagtcattgctgcatatttcctgctggtcattggcgttggc
ttgtggtccatgtgcagaaccaacagaggcactgtgggcggctacttcctggcaggacgc
agcatggtgtggtggccggttggggcctctctcttcgccagcaacatcggcagtggccac
tttgtgggcctggcagggactggcgctgcaagtggcttggctgttgctggattcgagtgg
aatgcgctcttcgtggtgctgctactgggctggctgtttgcacccgtgtacctgacagcg
ggggtcatcacgatgccacagtacctgcgcaagcgcttcggcggccgccgcatccgcctc
tacctgtctgtgctctcccttttcctgtacatcttcaccaagatctcagtggacatgttc
tccggagctgtattcatccagcaggctctgggctggaacatctatgcctccgtcatcgcg
cttctgggcatcaccatgatttacacggtgacaggagggctggccgcgctgatgtacacg
gacacggtacagaccttcgtcattctggggggcgcctgcatcctcatgggttacgccttc
cacgaggtgggcgggtattcgggtctcttcgacaaatacctgggagcagcgacttcgctg
acggtgtccgaggatccagccgtgggaaacatctccagcttctgctatcgaccccggccc
gactcctaccacctgctccggcaccccgtgaccggggatctgccgtggcccgcgctgctc
ctcggactcacaatcgtctcgggctggtactggtgcagcgaccaggtcatcgtgcagcgc
tgcctggccgggaagagcctgacccacatcaaggcgggctgcatcctgtgtgggtacctg
aagctgacgcccatgtttctcatggtcatgccaggcatgatcagccgcattctgtaccca
gacgaggtggcgtgcgtggtgcctgaggtgtgcaggcgcgtgtgcggcacggaggtgggc
tgctccaacatcgcctacccgcggctcgtcgtgaagctcatgcccaacggtctgcgcgga
ctcatgctggcggtcatgctggccgcgctcatgtcctcgctggcctccatcttcaacagc
agcagcacgctcttcaccatggacatctacacgcgcctgcggccacgcgccggcgaccgc
gagctgctgctggtgggacggctctgggtggtgttcatcgtggtagtgtcggtggcctgg
cttcccgtggtgcaggcggcacagggcgggcagctcttcgattacatccaggcagtctct
agctacctggcaccgcccgtgtccgccgtcttcgtgctggcgctcttcgtgccgcgcgtt
aatgagcagggcgccttctggggactcatcgggggcctgctgatgggcctggcacgcctg
attcccgagttctccttcggctcgggcagctgtgtgcagccctcggcgtgcccagctttc
ctctgcggcgtgcactacctctacttcgccattgtgctgttcttctgctctggcctcctc
accctcacggtctccctgtgcaccgcgcccatccccagaaagcacctccaccgcctggtc
ttcagtctccggcatagcaaggaggaacgggaggacctggatgctgatgagcagcaaggc
tcctcactccctgtacagaatgggtgcccagagagtgccatggagatgaatgagccccag
gccccggcaccaagcctcttccgccagtgcctgctctggttttgtggaatgagcagaggt
ggggtgggcagtcctccgccccttacccaggaggaggcagcggcagcagccaggcggctg
gaggacatcagcgaggacccgagctgggcccgtgtggtcaacctcaatgccctgctcatg
atggcagtggccgtgttcctctggggcttctatgcctaa

DBGET integrated database retrieval system