KEGG   Homo sapiens (human): 6526
Entry
6526              CDS       T01001                                 
Symbol
SLC5A3, BCW2, SMIT, SMIT1, SMIT2
Name
(RefSeq) solute carrier family 5 member 3
  KO
K14383  solute carrier family 5 (sodium/myo-inositol cotransporter), member 3
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    6526 (SLC5A3)
Transporters [BR:hsa02000]
 Solute carrier family (SLC)
  SLC5: Sodium glucose cotransporter
   6526 (SLC5A3)
SSDB
Motif
Pfam: SSF
Other DBs
NCBI-GeneID: 6526
NCBI-ProteinID: NP_008864
OMIM: 600444
HGNC: 11038
Ensembl: ENSG00000198743
Position
21:34073578..34106260
AA seq 718 aa
MRAVLDTADIAIVALYFILVMCIGFFAMWKSNRSTVSGYFLAGRSMTWVAIGASLFVSNI
GSEHFIGLAGSGAASGFAVGAWEFNALLLLQLLGWVFIPIYIRSGVYTMPEYLSKRFGGH
RIQVYFAALSLILYIFTKLSVDLYSGALFIQESLGWNLYVSVILLIGMTALLTVTGGLVA
VIYTDTLQALLMIIGALTLMIISIMEIGGFEEVKRRYMLASPDVTSILLTYNLSNTNSCN
VSPKKEALKMLRNPTDEDVPWPGFILGQTPASVWYWCADQVIVQRVLAAKNIAHAKGSTL
MAGFLKLLPMFIIVVPGMISRILFTDDIACINPEHCMLVCGSRAGCSNIAYPRLVMKLVP
VGLRGLMMAVMIAALMSDLDSIFNSASTIFTLDVYKLIRKSASSRELMIVGRIFVAFMVV
ISIAWVPIIVEMQGGQMYLYIQEVADYLTPPVAALFLLAIFWKRCNEQGAFYGGMAGFVL
GAVRLILAFAYRAPECDQPDNRPGFIKDIHYMYVATGLFWVTGLITVIVSLLTPPPTKEQ
IRTTTFWSKKNLVVKENCSPKEEPYKMQEKSILRCSENNETINHIIPNGKSEDSIKGLQP
EDVNLLVTCREEGNPVASLGHSEAETPVDAYSNGQAALMGEKERKKETDDGGRYWKFIDW
FCGFKSKSLSKRSLRDLMEEEAVCLQMLEETRQVKVILNIGLFAVCSLGIFMFVYFSL
NT seq 2157 nt   +upstreamnt  +downstreamnt
atgagagctgtactggacacagcagacattgccatagtggccctgtattttatcctggtc
atgtgcattggtttttttgccatgtggaaatctaatagaagcaccgtgagtggatacttc
ctggcggggcgctctatgacctgggtagcaattggtgcctctctgtttgtgagcaatatt
gggagtgagcacttcattgggctggcaggatctggagctgcaagtggatttgcagtgggc
gcatgggaattcaatgccttactgcttttacaacttctgggatgggttttcatcccaatt
tacatccggtcaggggtatataccatgcctgaatacttgtccaagcgatttggtggccat
aggattcaggtctattttgcagccttgtctctgattctctatattttcaccaagctctcg
gtggatctgtattcgggtgccctttttatccaggagtctttgggttggaatctttatgtg
tctgtcatcctgctcattggcatgactgctttgctgactgtcaccggaggccttgttgca
gtgatctacacagacactctgcaggctctgctcatgatcattggggcacttacacttatg
attattagcataatggagattggcgggtttgaggaagttaagagaaggtacatgttggcc
tcacccgatgtcacttccatcttattgacatacaacctttccaacacaaattcttgtaat
gtctcccctaagaaagaagccctgaaaatgctgcggaatccaacagatgaagatgttcct
tggcctggattcattcttgggcagaccccagcttcagtatggtactggtgtgctgaccaa
gtcatcgtgcagagggtccttgcagccaaaaacattgctcatgccaaaggctctactctt
atggctggcttcttaaagctcctgccaatgtttatcatagttgtcccaggaatgatttcc
aggatactgtttactgatgatatagcttgcatcaacccagagcactgcatgctggtgtgt
ggaagcagagctggttgctccaatattgcttacccacgcctggtgatgaagctggttcct
gtgggccttcggggtttaatgatggcagtgatgattgcagctctgatgagtgacttagac
tctatctttaacagtgccagtaccatattcaccctcgatgtgtacaaacttatccgcaag
agcgcaagctcccgggagttaatgattgtggggaggatatttgtggcatttatggtggtg
atcagcatagcatgggtgccaatcatcgtggagatgcaaggaggccagatgtacctttac
attcaggaggtagcagattacctgacacccccagtggcagccttgttcctgctggcaatt
ttctggaagcgctgcaatgaacaaggggctttctatggtggaatggctggctttgttctt
ggagcagtccgtttgatactggcctttgcctaccgtgccccagaatgtgaccaacctgat
aataggccgggcttcatcaaagacatccattatatgtatgtggccacaggattgttttgg
gtcacgggactcattactgtaattgtgagccttctcacaccacctcccacaaaggaacag
attcgaaccaccaccttttggtctaagaagaacctggtggtgaaggagaactgctcccca
aaagaggaaccatacaaaatgcaagaaaagagcattctgagatgcagtgagaataatgag
accatcaaccacatcattcccaacgggaaatctgaagacagcattaagggccttcagcct
gaagatgttaatctgttggtaacctgcagagaggagggcaacccagtggcatccttaggt
cattcagaggcagaaacaccagttgacgcttactccaatgggcaagcagctctcatgggt
gagaaagagagaaagaaagaaacggatgatggaggtcggtactggaagttcatagactgg
ttttgtggctttaaaagtaagagcctcagcaagaggagtctcagagacctgatggaagag
gaggctgtttgtttacagatgctagaagagactcggcaagttaaagtaatactaaatatt
ggactttttgctgtgtgttcacttggaattttcatgtttgtttatttctccttatga

DBGET integrated database retrieval system