KEGG   Homo sapiens (human): 65266
Entry
65266             CDS       T01001                                 

Gene name
WNK4, PHA2B, PRKWNK4
Definition
(RefSeq) WNK lysine deficient protein kinase 4
  KO
K08867  WNK lysine deficient protein kinase [EC:2.7.11.1]
Organism
hsa  Homo sapiens (human)
Disease
H00243  Hyperkalemic distal renal tubular acidosis (RTA type 4)
H02310  Renal tubular acidosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    65266 (WNK4)
   01009 Protein phosphatases and associated proteins [BR:hsa01009]
    65266 (WNK4)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     65266 (WNK4)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: Other
  Wnk family
   65266 (WNK4)
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     65266 (WNK4)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr OSR1_C Pkinase_fungal
Other DBs
NCBI-GeneID: 65266
NCBI-ProteinID: NP_115763
OMIM: 601844
HGNC: 14544
Ensembl: ENSG00000126562
Vega: OTTHUMG00000180650
Pharos: Q96J92(Tbio)
UniProt: Q96J92
Position
17q21.2
AA seq 1243 aa
MLASPATETTVLMSQTEADLALRPPPPLGTAGQPRLGPPPRRARRFSGKAEPRPRSSRLS
RRSSVDLGLLSSWSLPASPAPDPPDPPDSAGPGPARSPPPSSKEPPEGTWTEGAPVKAAE
DSARPELPDSAVGPGSREPLRVPEAVALERRREQEEKEDMETQAVATSPDGRYLKFDIEI
GRGSFKTVYRGLDTDTTVEVAWCELQTRKLSRAERQRFSEEVEMLKGLQHPNIVRFYDSW
KSVLRGQVCIVLVTELMTSGTLKTYLRRFREMKPRVLQRWSRQILRGLHFLHSRVPPILH
RDLKCDNVFITGPTGSVKIGDLGLATLKRASFAKSVIGTPEFMAPEMYEEKYDEAVDVYA
FGMCMLEMATSEYPYSECQNAAQIYRKVTSGRKPNSFHKVKIPEVKEIIEGCIRTDKNER
FTIQDLLAHAFFREERGVHVELAEEDDGEKPGLKLWLRMEDARRGGRPRDNQAIEFLFQL
GRDAAEEVAQEMVALGLVCEADYQPVARAVRERVAAIQRKREKLRKARELEALPPEPGPP
PATVPMAPGPPSVFPPEPEEPEADQHQPFLFRHASYSSTTSDCETDGYLSSSGFLDASDP
ALQPPGGVPSSLAESHLCLPSAFALSIPRSGPGSDFSPGDSYASDAASGLSDVGEGMGQM
RRPPGRNLRRRPRSRLRVTSVSDQNDRVVECQLQTHNSKMVTFRFDLDGDSPEEIAAAMV
YNEFILPSERDGFLRRIREIIQRVETLLKRDTGPMEAAEDTLSPQEEPAPLPALPVPLPD
PSNEELQSSTSLEHRSWTAFSTSSSSPGTPLSPGNPFSPGTPISPGPIFPITSPPCHPSP
SPFSPISSQVSSNPSPHPTSSPLPFSSSTPEFPVPLSQCPWSSLPTTSPPTFSPTCSQVT
LSSPFFPPCPSTSSFPSTTAAPLLSLASAFSLAVMTVAQSLLSPSPGLLSQSPPAPPSPL
PSLPLPPPVAPGGQESPSPHTAEVESEASPPPARPLPGEARLAPISEEGKPQLVGRFQVT
SSKEPAEPLPLQPTSPTLSGSPKPSTPQLTSESSDTEDSAGGGPETREALAESDRAAEGL
GAGVEEEGDDGKEPQVGGSPQPLSHPSPVWMNYSYSSLCLSSEESESSGEDEEFWAELQS
LRQKHLSEVETLQTLQKKEIEDLYSRLGKQPPPGIVAPAAMLSSRQRRLSKGSFPTSRRN
SLQRSEPPGPGIMRRNSLSGSSTGSQEQRASKGVTFAGDVGRM
NT seq 3732 nt   +upstreamnt  +downstreamnt
atgttggcatccccggccacggagaccaccgtcctcatgtcccagactgaggccgacctg
gccctgcggcccccgcctcctcttggcaccgcggggcagccccgcctcgggccccctcct
cgccgagcgcgccgcttctccgggaaggctgagccccggccgcgctcttctcgtctcagc
cgccgtagctcagtcgacttggggctgctgagctcttggtccctgccagcctcacccgct
ccggacccccccgatcctccggactccgctggtcctggccccgcgaggagcccaccgcct
agctccaaagaaccccccgagggcacgtggaccgagggagcccctgtgaaggctgcggaa
gactccgcgcgtcccgagctcccggactctgcagtgggcccggggtccagggagccgcta
agggtccctgaagctgtggccctagagcggcggcgggagcaggaagaaaaggaggacatg
gagacccaggctgtggcaacgtcccccgatggccgatacctcaagtttgacatcgagatt
ggacgtggctccttcaagacggtgtatcgagggctagacaccgacaccacagtggaggtg
gcctggtgtgagctgcagactcggaaactgtctagagctgagcggcagcgcttctcagag
gaggtggagatgctcaaggggctgcagcaccccaacatcgtccgcttctatgattcgtgg
aagtcggtgctgaggggccaggtttgcatcgtgctggtcaccgaactcatgacctcgggc
acgctcaagacgtacctgaggcggttccgggagatgaagccgcgggtccttcagcgctgg
agccgccaaatcctgcggggacttcatttcctacactcccgggttcctcccatcctgcac
cgggatctcaagtgcgacaatgtctttatcacgggacctactggctctgtcaaaatcggg
gacctgggcctggccacgctcaagcgcgcctcctttgccaagagtgtcatcgggaccccg
gaattcatggcccccgagatgtacgaggaaaagtacgatgaggccgtggacgtgtacgcg
ttcggcatgtgcatgctggagatggccacctctgagtacccgtactccgagtgccagaat
gccgcgcaaatctaccgcaaggtcacttcgggcagaaagccgaacagcttccacaaggtg
aagatacccgaggtgaaggagatcattgaaggctgcatccgcacggataagaacgagagg
ttcaccatccaggacctcctggcccacgccttcttccgcgaggagcgcggtgtgcacgtg
gaactagcggaggaggacgacggcgagaagccgggcctcaagctctggctgcgcatggag
gacgcgcggcgcggggggcgcccacgggacaaccaggccatcgagttcctgttccagctg
ggccgggacgcggccgaggaggtggcacaggagatggtggctctgggcttggtctgtgaa
gccgattaccagccagtggcccgtgcagtacgtgaacgggttgctgccatccagcgaaag
cgtgagaagctgcgtaaagcaagggaattggaggcactcccaccagagccaggacctcca
ccagcaactgtgcccatggcccccggtccccccagtgtcttcccccctgagcctgaggag
ccagaggcagaccagcaccagcccttccttttccgccacgccagctactcatctaccact
tcggattgcgagactgatggctacctcagctcctccggcttcctggatgcctcagaccct
gcccttcagccccctgggggggtgccatccagcctggctgagtcccatctctgcctgccc
tcggcttttgccctatccattccacgttctggccctggaagtgacttttcccccggggac
agctatgcctcagatgcagcttcaggccttagcgatgtgggagaagggatgggacaaatg
aggagacccccagggaggaatctccggcgcagaccccgatcccggctgcgggtcactagt
gtctcagaccagaatgacagagtggttgagtgccagctacagacccataacagcaagatg
gtgaccttccgatttgatctggatggggacagcccggaagagattgcagctgccatggta
tataacgagttcattctgccttcggagcgagatggatttctcagacggattcgggagatt
atccagcgagtggagaccctgttgaagagagacactggccccatggaggctgctgaagac
accctaagcccccaggaggagccagcaccattacctgccctgcccgtccccctcccagac
ccatccaatgaagagctccagagcagcacctccctggagcacaggagctggacagccttc
tccacctcctcatcttctcctggaactcctttgtctcctggaaacccattttcccctgga
acccccatttccccaggtcccatcttccccatcacttctcccccatgtcatcccagcccc
tccccattctcccccatttcttcccaggtctcctcaaatccctctccacaccccaccagc
tctccacttccattctcctccagcacacccgagtttccggtcccactctctcagtgtccc
tggagttctctccccacgacttctccacctacgttctctcccacttgttctcaggtcact
cttagttcccctttctttcctccgtgcccctccacttcttccttcccctccaccacagca
gcccctctcctttctctggctagtgccttctcactggctgtgatgactgtggcccagtcc
ctgctgtccccctcacctgggctcctttcccagtctcctccagcccctcctagtcccctc
cctagcctgccccttccccctcccgttgctcctggtggccaggaaagcccttcaccccac
acagctgaggtggagagtgaggcctcaccacctcctgctcggcccctcccaggggaagcc
aggctggcgcccatctctgaagagggaaagccgcagcttgttgggcgtttccaagtgact
tcatccaaggaaccggctgagcctcttcccttgcagccaacatcccccactctctctggt
tctccaaaaccttcaacccctcagctcacttcagagagctcagatacagaggacagtgct
ggaggcgggccagagaccagggaagctctggctgagagcgaccgtgcagctgagggtctg
ggggctggagttgaggaggaaggagatgatgggaaggaaccccaagttgggggcagcccc
caacccctgagccatcccagcccagtgtggatgaactactcctacagcagcctgtgtttg
agcagcgaggagtcagaaagcagtggggaagatgaggagttctgggctgagctgcagagt
cttcggcagaagcacttgtcagaggtggaaacactacagacactacagaaaaaagaaatt
gaagatttgtacagccggctggggaagcagcccccaccgggtattgtggccccagctgct
atgctgtccagccgccagcgccgcctctccaagggcagcttccccacctcccgccgcaac
agcctacagcgctctgagcccccaggccctggcatcatgcgaaggaactctctgagtggc
agcagcaccggctcccaggagcagcgggcaagcaagggggtgacattcgccggggatgtt
ggcaggatgtga

DBGET integrated database retrieval system