KEGG   Homo sapiens (human): 65267Help
Entry
65267             CDS       T01001                                 

Gene name
WNK3, PRKWNK3
Definition
(RefSeq) WNK lysine deficient protein kinase 3
  KO
K08867  WNK lysine deficient protein kinase [EC:2.7.11.1]
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    65267 (WNK3)
   01009 Protein phosphatases and associated proteins [BR:hsa01009]
    65267 (WNK3)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     65267 (WNK3)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: Other
  Wnk family
   65267 (WNK3)
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     65267 (WNK3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr OSR1_C
Motif
Other DBs
NCBI-GeneID: 65267
NCBI-ProteinID: NP_065973
OMIM: 300358
HGNC: 14543
Ensembl: ENSG00000196632
Vega: OTTHUMG00000021626
Pharos: Q9BYP7(Tbio)
UniProt: Q9BYP7
Structure
PDB: 

Position
Xp11.22
AA seq 1800 aa AA seqDB search
MATDSGDPASTEDSEKPDGISFENRVPQVAATLTVEARLKEKNSTFSASGETVERKRFFR
KSVEMTEDDKVAESSPKDERIKAAMNIPRVDKLPSNVLRGGQEVKYEQCSKSTSEISKDC
FKEKNEKEMEEEAEMKAVATSPSGRFLKFDIELGRGAFKTVYKGLDTETWVEVAWCELQD
RKLTKAEQQRFKEEAEMLKGLQHPNIVRFYDSWESILKGKKCIVLVTELMTSGTLKTYLK
RFKVMKPKVLRSWCRQILKGLQFLHTRTPPIIHRDLKCDNIFITGPTGSVKIGDLGLATL
MRTSFAKSVIGTPEFMAPEMYEEHYDESVDVYAFGMCMLEMATSEYPYSECQNAAQIYRK
VTSGIKPASFNKVTDPEVKEIIEGCIRQNKSERLSIRDLLNHAFFAEDTGLRVELAEEDD
CSNSSLALRLWVEDPKKLKGKHKDNEAIEFSFNLETDTPEEVAYEMVKSGFFHESDSKAV
AKSIRDRVTPIKKTREKKPAGCLEERRDSQCKSMGNVFPQPQNTTLPLAPAQQTGAECEE
TEVDQHVRQQLLQRKPQQHCSSVTGDNLSEAGAASVIHSDTSSQPSVAYSSNQTMGSQMV
SNIPQAEVNVPGQIYSSQQLVGHYQQVSGLQKHSKLTQPQILPLVQGQSTVLPVHVLGPT
VVSQPQVSPLTVQKVPQIKPVSQPVGAEQQAALLKPDLVRSLNQDVATTKENVSSPDNPS
GNGKQDRIKQRRASCPRPEKGTKFQLTVLQVSTSGDNMVECQLETHNNKMVTFKFDVDGD
APEDIADYMVEDNFVLESEKEKFVEELRAIVGQAQEILHVHFATERATGVDSITVDSNSS
QTGSSEQVQINSTSTQTSNESAPQSSPVGRWRFCINQTIRNRETQSPPSLQHSMSAVPGR
HPLPSPKNTSNKEISRDTLLTIENNPCHRALFTSKSEHKDVVDGKISECASVETKQPAIL
YQVEDNRQIMAPVTNSSSYSTTSVRAVPAECEGLTKQASIFIPVYPCHQTASQADALMSH
PGESTQTSGNSLTTLAFDQKPQTLSVQQPAMDAEFISQEGETTVNTEASSPKTVIPTQTP
GLEPTTLQPTTVLESDGERPPKLEFADNRIKTLDEKLRNLLYQEHSISSIYPESQKDTQS
IDSPFSSSAEDTLSCPVTEVIAISHCGIKDSPVQSPNFQQTGSKLLSNVAASQPANISVF
KRDLNVITSVPSELCLHEMSSDASLPGDPEAYPAAVSSGGAIHLQTGGGYFGLSFTCPSL
KNPISKKSWTRKLKSWAYRLRQSTSFFKRSKVRQVETEEMRSAIAPDPIPLTRESTADTR
ALNRCKAMSGSFQRGRFQVITIPQQQSAKMTSFGIEHISVFSETNHSSEEAFIKTAKSQL
VEIEPATQNPKTSFSYEKLQALQETCKENKGVPKQGDNFLSFSAACETDVSSVTPEKEFE
ETSATGSSMQSGSELLLKEREILTAGKQPSSDSEFSASLAGSGKSVAKTGPESNQCLPHH
EEQAYAQTQSSLFYSPSSPMSSDDESEIEDEDLKVELQRLREKHIQEVVNLQTQQNKELQ
ELYERLRSIKDSKTQSTEIPLPPASPRRPRSFKSKLRSRPQSLTHVDNGIVATGKSCLIN
ELENPLCVESNAASCQQSPASKKGMFTDDLHKLVDDWTKEAVGNSLIKPSLNQLKQSQHK
LETENWNKVSENTPSTMGYTSTWISSLSQIRGAVPTSLPQGLSLPSFPGPLSSYGMPHVC
QYNAVAGAGYPVQWVGISGTTQQSVVIPAQSGGPFQPGMNMQAFPTSSVQNPATIPPGPK
NT seq 5403 nt NT seq  +upstreamnt  +downstreamnt
atggccactgattcaggggatccagccagcacagaagattctgagaaacctgatggaatt
tcatttgaaaacagagttccccaggtcgctgcaactttgacagtagaagctagactaaag
gagaaaaacagtaccttctctgcttctggggaaactgtagaaaggaagagatttttccga
aagagtgttgaaatgacggaagatgacaaagttgccgaatcatcccccaaagatgagaga
attaaggctgcaatgaatattccaagagtagataagcttccttcaaatgtgttgagaggt
ggacaagaagttaaatatgaacagtgttcaaagtcaacctcagaaatctcaaaagattgt
ttcaaggagaaaaatgaaaaggaaatggaagaagaagcagaaatgaaggctgtagctact
tctcctagtggcagattcctgaaatttgacatagaactaggaagaggagcatttaaaaca
gtatataaaggactggacactgaaacatgggttgaggttgcttggtgtgagctgcaggac
cgaaagttaaccaaagctgagcagcaaagattcaaggaagaagcagagatgttgaagggt
ctccagcaccccaatatagttcgattttatgattcctgggaatctatattaaaaggaaag
aaatgtattgtattagtgactgaactaatgacatctgggaccttaaagacgtacttaaaa
cgatttaaagtcatgaaaccaaaggtcttaaggagctggtgcaggcaaattttaaagggg
ttgcagttcttgcacactaggactcctcctattattcaccgggatctgaagtgtgacaat
attttcatcacgggacccactggatctgtgaagattggtgatctaggattagccacctta
atgcgtacctcatttgctaagagtgtcattggaactcctgagtttatggctccagagatg
tatgaagaacactatgatgaatccgtagatgtttatgcttttggaatgtgtatgctggaa
atggccacatcggagtatccttattctgagtgtcagaatgcagctcaaatataccggaaa
gtaactagtggcataaaaccagccagcttcaataaagtcactgatcctgaagtcaaagaa
atcattgaaggatgtattcgtcaaaacaaatctgaaaggttgtctatcagggacctatta
aaccatgcattttttgctgaggatacaggactgagggtggagttagcagaagaagatgat
tgctcaaattcatcccttgctttaagactctgggttgaagaccctaaaaaattgaaaggc
aaacacaaagacaatgaagctattgaatttagtttcaacttagaaacagatacacctgag
gaagtagcatatgaaatggtcaagtctgggttcttccatgaaagtgattccaaagctgtt
gctaaatccattagagaccgggtgacgccaataaagaagacaagagagaagaagcctgct
ggctgtttggaagaacgcagggattctcagtgcaagtctatggggaatgtattccctcag
ccccagaatacaactttaccccttgctcccgctcagcaaactggggctgaatgtgaagaa
actgaagttgatcaacatgttagacaacagcttctacaaagaaaaccacagcagcactgc
tcctctgttacaggtgacaatttgtctgaggcaggagctgcatcagttatacattcagat
acttcaagtcagcccagtgtagcctattcctcaaatcaaacgatgggctctcaaatggtt
tctaatatcccgcaggctgaagtaaatgttccagggcaaatttattcatctcagcaacta
gtaggacattaccagcaagtttcagggttacagaagcattcaaagctgactcagccgcag
attttgcctttggttcaaggtcagtccactgttttacctgtacatgtccttggaccgaca
gttgtttcacaaccccaggtttccccattaactgttcagaaggtcccacagataaagcct
gtatcccaaccagttggagctgaacaacaagcagctcttctaaaaccagatttagttcga
agcttgaatcaagatgtggcaactacgaaggaaaacgtcagtagccctgataacccaagt
ggaaatggcaaacaggatcggatcaaacagagaagagcttcctgtccccgaccagagaag
gggactaaatttcagcttaccgtccttcaggtatcaacctctggagataacatggtagag
tgtcagctggagacacacaacaacaagatggtcaccttcaagtttgatgttgatggtgat
gcgccagaggatattgcagactatatggttgaagataactttgtgctggaaagtgagaaa
gaaaaatttgtagaagaattgagagctattgtaggtcaagcccaggagatccttcatgtc
cactttgccacagaaagagccactggagttgattctattactgtggactccaacagtagc
cagacagggtcatctgaacaagtacagataaattctacatctactcaaaccagcaatgaa
tctgctcctcagtcatccccagttggtcggtggcgattctgtatcaatcagacgataaga
aaccgtgagactcagtctcctccttctcttcagcattccatgtctgcggttcctggccga
catccacttcctagtccaaaaaacacaagtaataaggaaatatcacgggacacattgctc
actatagaaaataatccatgccaccgtgcacttttcacctccaaatcagaacacaaggat
gtggttgatggtaagatttctgaatgtgctagtgtagaaaccaagcagccagctatactt
tatcaagtggaagataacaggcagataatggcaccagttactaatagttccagttactct
actacttcagttcgtgcagttccagctgaatgtgagggactcaccaaacaagcaagcata
ttcatacctgtgtatccatgtcaccaaactgccagtcaggctgatgcacttatgtcccat
cctggcgaatcaactcagacttctggtaactctcttacaactctggcatttgatcaaaag
cctcaaaccttatcagtacagcagccagctatggatgcagagtttatttctcaagaagga
gaaactacagtgaacactgaagcaagttctcctaagacagtcattcccactcagacccct
ggccttgaaccaactacccttcaacccactactgtcctggaatcagatggagaaagacct
ccaaaactggagtttgcagacaaccgaattaaaactctggatgaaaaattaagaaacttg
ctctatcaggagcacagcatctctagcatctatcccgagagtcagaaggatacccaaagc
atagactctccattttcttcctctgctgaagataccctctcctgtccagtgacagaagtc
atagccatcagtcactgtggaattaaagatagccctgtacaatcccctaatttccaacag
acaggctctaagcttctgtccaatgtggctgcaagtcagcctgctaatatatcagtgttc
aaaagggacctgaatgtgataacttctgtacccagcgaattgtgtttacatgagatgtcc
tcagatgcttcacttccaggggatccagaggcctatcctgctgctgtgtcaagcggtgga
gccattcatctgcagacaggaggtggatattttggcctaagctttacttgtcctagtctc
aaaaatcctattagcaagaaatcctggactcgcaaattaaaaagctgggcatacaggcta
cggcagtcaaccagctttttcaagagatcaaaagtccgtcaagtggaaacagaagagatg
agatcagcaattgctcctgatcccattcctctgacacgggagtccacagctgatactagg
gctttgaatagatgtaaagcgatgagtggatcatttcagcggggtcggttccaggtgatt
acaattcctcagcagcagtcagcaaaaatgacatcttttggaatagaacacatatcagtg
ttcagtgagacaaaccattctagtgaagaagcctttattaaaacagcaaagtctcagttg
gtagaaatagaacctgccacacaaaatccaaaaacttcgttttcttatgagaagttacaa
gctcttcaggaaacctgtaaagaaaataaaggagttcccaaacaaggtgacaacttctta
tctttcagcgcagcttgtgagactgatgtatcttcagtgaccccagaaaaggaatttgaa
gaaacttcagccacaggaagtagcatgcagtctggatctgaactgttgcttaaagagaga
gagatattgactgctgggaaacagcctagctctgatagtgaattttcagccagtcttgct
ggcagtggaaagtcagtggcaaagactggtccagagagtaatcagtgcttaccacaccac
gaagaacaagcttatgctcaaacacagagttcactcttctattcgccatcttccccaatg
agcagtgatgatgaatcagaaatagaggatgaggacttgaaggtggagcttcaaagatta
cgagaaaaacacattcaggaggtggtaaatcttcaaacccagcagaataaggagctgcag
gagctctatgaacgccttcggtcaattaaagatagcaaaacccaatctactgagattcct
ttgccacctgcatcaccacgtcgaccaagatctttcaaaagcaaacttcgaagccgcccc
cagtccttgacacatgtggacaatggcatagttgctacagggaaaagctgccttataaat
gagttggaaaatccactgtgtgtggagagtaatgcagcatcatgccaacagtctccagcc
agtaaaaaagggatgttcacagatgacttacacaagctggtggatgactggacaaaggaa
gcagtaggaaattctcttattaagccaagtttaaaccaacttaaacaaagtcaacacaaa
ctagagacagaaaactggaataaagtatctgaaaatactccgtctactatgggctacaca
tcaacatggatttcttctctgtcccaaatccgtggagctgtcccaacttccttgccacaa
ggactctcactcccttcatttcctgggccattatcatcatatggaatgcctcacgtttgt
cagtataatgctgtggcgggggcggggtatccagtacagtgggtaggaatttcaggaaca
acacaacaatctgtagtaattcccgcccaatctgggggaccattccagccagggatgaat
atgcaggcatttccaacttcatcagtgcagaatcctgccacaatccctcctggtcctaaa
tga

DBGET integrated database retrieval system