KEGG   Homo sapiens (human): 6527Help
Entry
6527              CDS       T01001                                 

Gene name
SLC5A4, DJ90G24.4, SAAT1, SGLT3
Definition
(RefSeq) solute carrier family 5 member 4
  KO
K14384  solute carrier family 5 (low affinity sodium-glucose cotransporter), member 4
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    6527 (SLC5A4)
Transporters [BR:hsa02000]
 Solute carrier family (SLC)
  SLC5: Sodium glucose cotransporter
   6527 (SLC5A4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SSF
Motif
Other DBs
NCBI-GeneID: 6527
NCBI-ProteinID: NP_055042
HGNC: 11039
Ensembl: ENSG00000100191
Vega: OTTHUMG00000150007
Pharos: Q9NY91(Tchem)
UniProt: Q9NY91
Position
22q12.3
AA seq 659 aa AA seqDB search
MASTVSPSTIAETPEPPPLSDHIRNAADISVIVIYFLVVMAVGLWAMLKTNRGTIGGFFL
AGRDMAWWPMGASLFASNIGSNHYVGLAGTGAASGVATVTFEWTSSVMLLILGWIFVPIY
IKSGVMTMPEYLKKRFGGERLQVYLSILSLFICVVLLISADIFAGAIFIKLALGLDLYLA
IFILLAMTAVYTTTGGLASVIYTDTLQTIIMLIGSFILMGFAFNEVGGYESFTEKYVNAT
PSVVEGDNLTISASCYTPRADSFHIFRDAVTGDIPWPGIIFGMPITALWYWCTNQVIVQR
CLCGKDMSHVKAACIMCAYLKLLPMFLMVMPGMISRILYTDMVACVVPSECVKHCGVDVG
CTNYAYPTMVLELMPQGLRGLMLSVMLASLMSSLTSIFNSASTLFTIDLYTKMRKQASEK
ELLIAGRIFVLLLTVVSIVWVPLVQVSQNGQLIHYTESISSYLGPPIAAVFVLAIFCKRV
NEQGAFWGLMVGLAMGLIRMITEFAYGTGSCLAPSNCPKIICGVHYLYFSIVLFFGSMLV
TLGISLLTKPIPDVHLYRLCWVLRNSTEERIDIDAEEKSQEETDDGVEEDYPEKSRGCLK
KAYDLFCGLQKGPKLTKEEEEALSKKLTDTSERPSWRTIVNINAILLLAVVVFIHGYYA
NT seq 1980 nt NT seq  +upstreamnt  +downstreamnt
atggccagtacggttagccccagcaccatagctgagaccccagagccacctccattgtct
gaccacatccgaaatgctgctgacatctcagtcattgtcatctattttctggtggtgatg
gctgttgggctgtgggcgatgctgaagaccaaccgaggtactataggaggcttcttcctc
gctggtcgtgatatggcctggtggccgatgggcgcctctctctttgccagtaacatcggc
agcaaccactatgtggggctggctgggacaggagcagcttcaggagtcgccaccgtaaca
tttgaatggacttcctcagtaatgttgctgattcttgggtggatctttgtccctatctac
atcaagtcgggggtgatgaccatgccggaatatctcaagaagcggtttggtggggagcga
ctccaggtctacctctccatcctctccctcttcatctgtgtggttttgttaatttctgca
gacatatttgctggagccatattcatcaagctggccttgggattggacctttacctggca
atcttcatcctcttggctatgactgctgtttacaccaccactgggggcttggcctcggtg
atttacacagacaccctccagaccatcatcatgctgattggctcttttattctcatgggg
tttgcatttaacgaagttggaggttatgagagctttaccgagaagtacgtgaatgccacc
ccatccgtagtcgagggggacaacttgacaatcagtgccagttgctacacacctcgggcg
gactccttccacatcttccgagatgctgtgactggggacattccatggccaggaattata
tttggaatgcccattacagctttgtggtactggtgcacaaatcaggtcattgtgcagcgc
tgcctgtgtggcaaggacatgtctcacgtgaaggccgcttgcattatgtgtgcttacctg
aagctgctgcccatgttcctcatggtgatgccggggatgatcagccgcatcctgtacaca
gatatggtagcatgtgtggtaccttctgaatgcgtgaaacactgtggcgttgatgttggc
tgcaccaactacgcataccccacgatggtgctggaactgatgccccaaggactgcgaggc
ctgatgctttcggtcatgctggcctctctcatgagctccctgacctccatcttcaacagc
gccagcaccctcttcaccattgacctctacaccaagatgcggaagcaagcgtcggagaaa
gagctcctgatagctggacggatatttgttcttctattaactgttgtgagcattgtgtgg
gtcccactggtacaagtttctcaaaatggacaactaatccattacacagaatcaatttct
agctaccttgggcctccaattgcagctgtctttgtgcttgccatcttctgtaaaagagtc
aatgaacagggagcattctggggtctaatggttggacttgcaatgggcctcattcgtatg
ataacagagtttgcttatggaacagggagttgcttggctcccagtaactgtcccaagatt
atctgtggagtgcactatctgtacttttccatcgttctcttttttgggtccatgctggtc
accctgggaatttccctcttaacaaaacccattcctgatgtacatctgtaccgcctgtgc
tgggttcttcggaacagtacagaggagcgaatcgatatagatgcagaagagaaaagtcag
gaagaaacagatgatggtgttgaagaagattatcctgagaaatcacgtggatgcctcaag
aaagcttatgacttgttctgcggtttgcagaagggacccaagctaaccaaggaggaggag
gaagccttgagcaagaagctcacagacacgtctgagaggccctcgtggaggacaatagtg
aacatcaacgccatcctcctcctggctgtggtggtctttattcacggctactatgcctga

DBGET integrated database retrieval system