KEGG   Homo sapiens (human): 652968
Entry
652968            CDS       T01001                                 

Gene name
CASTOR1, GATSL3
Definition
(RefSeq) cytosolic arginine sensor for mTORC1 subunit 1
  KO
K23080  cytosolic arginine sensor for mTORC1 subunit 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04150  mTOR signaling pathway
Drug target
Sapanisertib: D11183
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04150 mTOR signaling pathway
    652968 (CASTOR1)
SSDB
Motif
Pfam: ACT_7 Castor1_N
Other DBs
NCBI-GeneID: 652968
NCBI-ProteinID: NP_001032755
OMIM: 617034
HGNC: 34423
Ensembl: ENSG00000239282
Vega: OTTHUMG00000150929
Pharos: Q8WTX7(Tdark)
UniProt: Q8WTX7
Structure
PDB: 
5I2C 5GT7 5GV2 5GS9 5GT8

Position
22q12.2
AA seq 329 aa
MELHILEHRVRVLSVARPGLWLYTHPLIKLLFLPRRSRCKFFSLTETPEDYTLMVDEEGF
KELPPSEFLQVAEATWLVLNVSSHSGAAVQAAGVTKIARSVIAPLAEHHVSVLMLSTYQT
DFILVREQDLSVVIHTLAQEFDIYREVGGEPVPVTRDDSSNGFPRTQHGPSPTVHPIQSP
QNRFCVLTLDPETLPAIATTLIDVLFYSHSTPKEAASSSPEPSSITFFAFSLIEGYISIV
MDAETQKKFPSDLLLTSSSGELWRMVRIGGQPLGFDECGIVAQIAGPLAAADISAYYIST
FNFDHALVPEDGIGSVIEVLQRRQEGLAS
NT seq 990 nt   +upstreamnt  +downstreamnt
atggagctgcacatcctagaacaccgggtgcgggtgctgagcgtcgcccgtcccggtctc
tggctctacacccacccgctcatcaagctgctcttcctgccccgccgcagccggtgcaag
ttcttcagcctgacggagacccctgaggattacacgcttatggtggacgaggagggcttt
aaagagctgcccccatctgagttcctgcaagtagctgaggccacatggctggtgctgaac
gtgtcgtctcacagcggtgcggcagtgcaggctgctggggtcaccaagatcgcccgttcg
gtcatcgcgccactggccgagcaccacgtgtctgtgctgatgctgtccacttaccagacg
gacttcatcctggtgcgggagcaggacctgtccgtggtgatccacacgctggcccaggag
ttcgacatttaccgcgaggtgggcggagagcctgtgcctgtgacgagggatgattccagc
aatggctttccccgcactcagcatgggcccagccccacggtgcatcccatccagagccca
cagaaccgcttctgtgtcctcacactggaccctgagacgcttccagccatcgccaccacc
ctcatagatgtcctcttctactcgcacagcacccccaaggaggcagcctctagcagtcct
gaacccagctccatcacgttctttgccttctccctcatcgagggttatatctccattgtc
atggatgctgaaacacagaaaaagttccccagtgacctcctgctgaccagctcctcgggg
gagctgtggaggatggtgcgcatcggtggacagcccctgggctttgatgaatgtggcatc
gtggcacagattgcaggtcccctggctgccgctgacatctctgcctactacatcagcacc
ttcaacttcgaccacgccctggtgcccgaggacggtatcggcagcgtcatcgaggtcctc
cagcggcggcaggaaggcctggcttcctga

DBGET integrated database retrieval system