KEGG   Homo sapiens (human): 653
Entry
653               CDS       T01001                                 
Symbol
BMP5
Name
(RefSeq) bone morphogenetic protein 5
  KO
K04663  bone morphogenetic protein 5
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04350  TGF-beta signaling pathway
hsa04390  Hippo signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    653 (BMP5)
   04390 Hippo signaling pathway
    653 (BMP5)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    653 (BMP5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    653 (BMP5)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  Transforming growth factors (RSTK binding)
   653 (BMP5)
SSDB
Motif
Pfam: TGFb_propeptide TGF_beta YkuD_2
Other DBs
NCBI-GeneID: 653
NCBI-ProteinID: NP_066551
OMIM: 112265
HGNC: 1072
Ensembl: ENSG00000112175
Pharos: P22003(Tbio)
UniProt: P22003 M9VUD0 A8K694
Position
6:complement(55753653..55875590)
AA seq 454 aa
MHLTVFLLKGIVGFLWSCWVLVGYAKGGLGDNHVHSSFIYRRLRNHERREIQREILSILG
LPHRPRPFSPGKQASSAPLFMLDLYNAMTNEENPEESEYSVRASLAEETRGARKGYPASP
NGYPRRIQLSRTTPLTTQSPPLASLHDTNFLNDADMVMSFVNLVERDKDFSHQRRHYKEF
RFDLTQIPHGEAVTAAEFRIYKDRSNNRFENETIKISIYQIIKEYTNRDADLFLLDTRKA
QALDVGWLVFDITVTSNHWVINPQNNLGLQLCAETGDGRSINVKSAGLVGRQGPQSKQPF
MVAFFKASEVLLRSVRAANKRKNQNRNKSSSHQDSSRMSSVGDYNTSEQKQACKKHELYV
SFRDLGWQDWIIAPEGYAAFYCDGECSFPLNAHMNATNHAIVQTLVHLMFPDHVPKPCCA
PTKLNAISVLYFDDSSNVILKKYRNMVVRSCGCH
NT seq 1365 nt   +upstreamnt  +downstreamnt
atgcatctgactgtatttttacttaagggtattgtgggtttcctctggagctgctgggtt
ctagtgggttatgcaaaaggaggtttgggagacaatcatgttcactccagttttatttat
agaagactacggaaccacgaaagacgggaaatacaaagggaaattctctctatcttgggt
ttgcctcacagacccagaccattttcacctggaaaacaagcgtcctctgcacctctcttt
atgctggatctctacaatgccatgaccaatgaagaaaatcctgaagagtcggagtactca
gtaagggcatccttggcagaagagaccagaggggcaagaaagggatacccagcctctccc
aatgggtatcctcgtcgcatacagttatctcggacgactcctctgaccacccagagtcct
cctctagccagcctccatgataccaactttctgaatgatgctgacatggtcatgagcttt
gtcaacttagttgaaagagacaaggatttttctcaccagcgaaggcattacaaagaattt
cgatttgatcttacccaaattcctcatggagaggcagtgacagcagctgaattccggata
tacaaggaccggagcaacaaccgatttgaaaatgaaacaattaagattagcatatatcaa
atcatcaaggaatacacaaatagggatgcagatctgttcttgttagacacaagaaaggcc
caagctttagatgtgggttggcttgtctttgatatcactgtgaccagcaatcattgggtg
attaatccccagaataatttgggcttacagctctgtgcagaaacaggggatggacgcagt
atcaacgtaaaatctgctggtcttgtgggaagacagggacctcagtcaaaacaaccattc
atggtggccttcttcaaggcgagtgaggtacttcttcgatccgtgagagcagccaacaaa
cgaaaaaatcaaaaccgcaataaatccagctctcatcaggactcctccagaatgtccagt
gttggagattataacacaagtgagcaaaaacaagcctgtaagaagcacgaactctatgtg
agcttccgggatctgggatggcaggactggattatagcaccagaaggatacgctgcattt
tattgtgatggagaatgttcttttccacttaacgcccatatgaatgccaccaaccacgct
atagttcagactctggttcatctgatgtttcctgaccacgtaccaaagccttgttgtgct
ccaaccaaattaaatgccatctctgttctgtactttgatgacagctccaatgtcattttg
aaaaaatatagaaatatggtagtacgctcatgtggctgccactaa

DBGET integrated database retrieval system