KEGG   Homo sapiens (human): 653166Help
Entry
653166            CDS       T01001                                 

Gene name
OR1D4, OR17-30
Definition
(RefSeq) olfactory receptor family 1 subfamily D member 4 (gene/pseudogene)
  KO
K04257  olfactory receptor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09157 Sensory system
   04740 Olfactory transduction
    653166 (OR1D4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    653166 (OR1D4)
G protein-coupled receptors [BR:hsa04030]
 Others
  Chemoreception
   Olfactory
    653166 (OR1D4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_4 7tm_1 7TM_GPCR_Srsx RIC1
Motif
Other DBs
NCBI-GeneID: 653166
NCBI-ProteinID: NP_003543
HGNC: 8185
Ensembl: ENSG00000255095
Vega: OTTHUMG00000166844
Position
17p13.3
AA seq 312 aa AA seqDB search
MDGDNQSENSQFLLLGISESPEQQQILFWMFLSMYLVTVLGNVLIILAISSDSHLHTPMY
FFLANLSFTDLFFVTNTIPKMLVNFQSQNKAISYAGCLTQLYFLVSLVTLDNLILAVMAY
DRYVAICCPLHYVTAMSPGLCVLLLSLCWGLSVLYGLLLTFLLTRVTFCGPREIHYLFCD
MYILLWLACSNTHIIHTVLIATGCFIFLTPLGFMTTSYVRIVRTILQMPSASKKYKTFST
CASHLGVVSLFYGMLAMVYLQPLHTYSMKDSVATVMYAVLTPMMNPFIYRLRNKDMHGAP
GRVLWRPFQRPK
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atggatggagataaccagagtgagaactcacagttccttctcctggggatctcagagagt
cctgagcagcagcagatcctgttttggatgttcctgtccatgtacctggtcacggtgctg
ggaaatgtgctcatcatcctggccatcagctctgattcccacctgcacacccccatgtac
ttcttcctggccaacctctccttcactgacctcttctttgtcaccaacacaatccccaag
atgctggtgaacttccagtcccagaacaaagccatctcctatgcagggtgtctgacacag
ctctacttcctggtctccttggtgaccctggacaacctcatcctggccgtgatggcgtat
gatcgctatgtggccatctgctgccccctccactatgtcacagccatgagccctgggctc
tgtgtcttgctcctctccttgtgttgggggctgtctgttctctatggcctcctcctcacc
ttcctcctgaccagggtgaccttctgtgggcctcgagagatccactacctcttctgtgac
atgtacatcctgctgtggctggcatgttccaacacccacatcattcacacagtgttgatt
gccactggctgcttcatcttcctcacccccttagggttcatgaccacatcctatgtacgt
attgtcagaaccatccttcaaatgccctcagcctctaagaaatacaaaaccttctctacc
tgtgcctcccatttgggtgtggtctccctcttttatgggatgcttgctatggtgtacctg
cagcccctccatacctactccatgaaggactcagtagccacagtgatgtatgctgtgctg
acacctatgatgaaccctttcatctacaggctgaggaacaaagacatgcatggggctccg
ggaagagtcctatggagaccctttcagaggcctaaatga

DBGET integrated database retrieval system